blastp task: [no title]

Status
finished finished
Modified 2013-12-06T12:09:23Z
CPU time (s) 0.4
Size (bytes) 150724
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins
           14,570 sequences; 7,175,750 total letters



Query= hgt

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLWIg379 KLWIg379 undefined product 793940:795592 forward MW:60691  1021    0.0  
  KLDOg333                                                            1015    0.0  
  KLAEg360 KLAEg360 undefined product 785500:787164 forward MW:61058   967    0.0  
  KLWIg101 KLWIg101 undefined product 216469:218493 forward MW:74992   244    9e-65
  KLAEg1547 KLAEg1547 undefined product 3264612:3266621 forward M...   237    9e-63
  KLDOg2691                                                            237    9e-63
  KLWIg3660 KLWIg3660 undefined product 7419975:7422182 forward M...   227    9e-60
  KLDOg4734                                                            225    3e-59
  KLWIg1971 KLWIg1971 undefined product 4071237:4072655 reverse M...   219    2e-57
  KLAEg4033 KLAEg4033 undefined product 8552313:8554025 forward M...   213    1e-55
  KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward M...   212    3e-55
  KLDOg1226                                                            204    1e-52
  KLDOg2154                                                            192    2e-49
  KLAEg2136 KLAEg2136 undefined product 4520230:4521936 reverse M...   191    7e-49
  KLAEg1384 KLAEg1384 undefined product 2927919:2929625 forward M...   178    5e-45
  KLAEg2135 KLAEg2135 undefined product 4517129:4518817 reverse M...   177    9e-45
  KLDOg3633                                                            175    5e-44
  KLDOg2155                                                            172    2e-43
  KLWIg1461 KLWIg1461 undefined product 2953274:2954977 forward M...   168    6e-42
  KLWIg4168 KLWIg4168 undefined product 8462108:8463787 forward M...   165    5e-41
  KLAEg1845 KLAEg1845 undefined product 3943115:3944440 reverse M...   158    4e-39
  KLAEg2614 KLAEg2614 undefined product 5530065:5531768 forward M...   158    6e-39
  KLWIg2895 KLWIg2895 undefined product 5880109:5881806 forward M...   157    9e-39
  KLWIg4564 KLWIg4564 undefined product 9312936:9314630 reverse M...   157    1e-38
  KLWIg2612 KLWIg2612 undefined product 5339084:5340703 reverse M...   156    2e-38
  KLDOg2506                                                            149    3e-36
  KLDOg2855                                                            149    3e-36
  KLWIg4394 KLWIg4394 undefined product 8954749:8956047 forward M...   147    1e-35
  KLAEg3319 KLAEg3319 undefined product 6983352:6984896 reverse M...   145    4e-35
  KLWIg2785 KLWIg2785 undefined product 5684463:5686046 reverse M...   145    4e-35
  KLAEg4445 KLAEg4445 undefined product 9466981:9468678 reverse M...   143    2e-34
  KLAEg2435 KLAEg2435 undefined product 5174375:5175973 reverse M...   142    2e-34
  KLDOg3292                                                            139    4e-33
  KLAEg3794 KLAEg3794 undefined product 8015797:8017485 forward M...   135    4e-32
  KLWIg4787 KLWIg4787 undefined product 9768780:9770465 forward M...   135    6e-32
  KLAEg349 KLAEg349 undefined product 761997:763964 forward MW:74182   130    2e-30
  KLDOg983                                                             127    1e-29
  KLDOg1861                                                            125    5e-29
  KLDOg3808                                                            124    9e-29
  KLDOg4833                                                            123    2e-28
  KLDOg2659                                                            121    7e-28
  KLWIg3342 KLWIg3342 undefined product 6776598:6778562 forward M...   120    2e-27
  KLDOg4814                                                            118    6e-27
  KLWIg793 KLWIg793 undefined product 1656864:1657811 reverse MW:...   117    1e-26
  KLAEg2468 KLAEg2468 undefined product 5234109:5235361 reverse M...   112    2e-25
  KLWIg4546 KLWIg4546 undefined product 9279057:9280016 forward M...   109    3e-24
  KLWIg1738 KLWIg1738 undefined product 3550425:3552140 reverse M...   108    5e-24
  KLDOg2454                                                            107    9e-24
  KLDOg1716                                                            102    3e-22
  KLAEg4274 KLAEg4274 undefined product 9099870:9101591 forward M...   100    1e-21
  KLWIg3722 KLWIg3722 undefined product 7538001:7539578 forward M...  89.0    5e-18
  KLDOg3879                                                           87.0    1e-17
  KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse M...  85.5    5e-17
  KLDOg4807                                                           80.1    2e-15
  KLWIg4655 KLWIg4655 undefined product 9481539:9483257 forward M...  56.6    2e-08
  KLAEg1606 KLAEg1606 undefined product 3385669:3387396 forward M...  51.6    7e-07
  KLAEg2867 KLAEg2867 undefined product 6050819:6052582 reverse M...  45.8    5e-05
  KLWIg3964 KLWIg3964 undefined product 8030823:8032538 reverse M...  43.1    2e-04
  KLDOg4259                                                           42.4    4e-04
  KLDOg2399                                                           42.4    5e-04
  KLDOg4817                                                           41.2    9e-04
  KLWIg2840 KLWIg2840 undefined product 5783630:5785102 reverse M...  40.0    0.002
  KLAEg112 KLAEg112 undefined product 249419:251197 reverse MW:64943  40.0    0.002
  KLDOg83                                                             39.7    0.003
  KLAEg1395 KLAEg1395 undefined product 2954212:2955972 reverse M...  37.7    0.012
  KLAEg230 KLAEg230 undefined product 494391:495848 forward MW:53356  37.0    0.020
  KLAEg2640 KLAEg2640 undefined product 5575575:5577059 reverse M...  36.2    0.032
  KLDOg4400                                                           35.0    0.068
  KLAEg1396 KLAEg1396 undefined product 2956612:2958378 reverse M...  35.0    0.075
  KLWIg3139 KLWIg3139 undefined product 6358337:6360121 reverse M...  34.7    0.091
  KLWIg2474 KLWIg2474 undefined product 5039439:5042441 forward M...  34.7    0.11 
  KLAEg2811 KLAEg2811 undefined product 5942026:5943783 reverse M...  33.5    0.19 
  KLDOg3059                                                           33.5    0.19 
  KLWIg3848 KLWIg3848 undefined product 7778807:7780372 reverse M...  32.0    0.57 
  KLDOg307                                                            31.6    0.92 
  KLDOg4084                                                           30.8    1.3  
  KLDOg807                                                            30.8    1.4  
  KLDOg3719                                                           30.4    1.7  
  KLDOg4012                                                           30.4    1.9  
  KLWIg364 KLWIg364 undefined product 758710:760620 reverse MW:71960  29.3    3.8  
  KLWIg2920 KLWIg2920 undefined product 5918867:5920390 reverse M...  29.3    4.3  
  KLWIg1767 KLWIg1767 undefined product 3621773:3623632 reverse M...  29.3    4.5  
  KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse M...  28.1    8.0  
  KLDOg984                                                            28.1    8.2  
  KLWIg4778 KLWIg4778 undefined product 9751232:9753124 reverse M...  28.1    8.2  


> KLWIg379 KLWIg379 undefined product 793940:795592 forward MW:60691
Length=551

 Score = 1021 bits (2639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/551 (88%), Positives = 524/551 (96%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            MSLKNWLL +DI+YEGTFYKKFP+++NIYVIG IACISGLMFGFDI+SMSSMIGTDVYK+
Sbjct  1    MSLKNWLLFKDIKYEGTFYKKFPNIHNIYVIGMIACISGLMFGFDISSMSSMIGTDVYKN  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YFS+PDSLT GGITASMAGGSFLGSLISPNFSDAFGRKVSLHIC+ LWIIG +LQCA+QD
Sbjct  61   YFSHPDSLTQGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICSCLWIIGTVLQCASQD  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            QAMLIVGRVISGMGIGFGSS AP+YCSE+SPP IRGT+SGLFQFSVTVGIM+LFY+GYGC
Sbjct  121  QAMLIVGRVISGMGIGFGSSVAPIYCSELSPPNIRGTVSGLFQFSVTVGIMILFYVGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFIDG AAFRITWGLQM+PG +L+VGVFFIPESPRWLANH+RWEET+ +VAN++ANGD+N
Sbjct  181  HFIDGTAAFRITWGLQMIPGFVLLVGVFFIPESPRWLANHNRWEETASVVANVIANGDIN  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQV+FQLEEIKEQVIID AAKNF +KDLFRKKTLPKTIVG+SAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVQFQLEEIKEQVIIDEAAKNFSFKDLFRKKTLPKTIVGISAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGY+GN+NLVASSIQYVLNV+MTIPALFLIDK G RPVLIIGGI MFTWLFSVA
Sbjct  301  VYIFNMAGYSGNSNLVASSIQYVLNVIMTIPALFLIDKAGIRPVLIIGGILMFTWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYSV  PGGVNGDDTVTI+IP  + SAA GVIASSYLFVC FAPTWGIGIWIYCSE
Sbjct  361  GILATYSVSVPGGVNGDDTVTIRIPDSHKSAAKGVIASSYLFVCSFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSA+SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSAVSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ETKGKTLEEIDQMW DNIPAW+T++Y+PQLP+++D+EG KLGLLGNPQHLEDV SNEKGL
Sbjct  481  ETKGKTLEEIDQMWADNIPAWKTSSYVPQLPVLEDDEGRKLGLLGNPQHLEDVKSNEKGL  540

Query  541  LDRSDSASNSN  551
            +D S+S SNSN
Sbjct  541  IDHSESNSNSN  551


> KLDOg333
Length=556

 Score = 1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/551 (88%), Positives = 515/551 (94%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            M LKNWLL+ DI YEGTFYKKFPH+YNIY IG IACISGLMFGFDI+SMSSMIGTD YKD
Sbjct  1    MPLKNWLLVSDIPYEGTFYKKFPHIYNIYCIGMIACISGLMFGFDISSMSSMIGTDAYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YF+ PDSLT GGITASMAGGSFLGS+ISPNF+D FGRKVSLHICA LWIIG ILQ AAQ+
Sbjct  61   YFNRPDSLTQGGITASMAGGSFLGSVISPNFTDTFGRKVSLHICATLWIIGCILQSAAQN  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            Q MLI GRVI+GMGIGFGSSAAPVYCSEI+PPKIRGTISGLFQFSVTVGIMVLFY+GYGC
Sbjct  121  QGMLIAGRVIAGMGIGFGSSAAPVYCSEIAPPKIRGTISGLFQFSVTVGIMVLFYVGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFI+  AAFRITWGLQMVPGLIL+VGVFFIPESPRWLAN DRWEE S IVAN+VANGDV 
Sbjct  181  HFIESTAAFRITWGLQMVPGLILLVGVFFIPESPRWLANRDRWEEASKIVANVVANGDVE  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQVRFQL+EIKEQV+ID+AAKNF YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVRFQLDEIKEQVMIDAAAKNFSYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGYTGNTNLVASSIQYVLNV+MTIPALFLIDK GRRPVL++GGIFM  WLFSVA
Sbjct  301  VYIFNMAGYTGNTNLVASSIQYVLNVIMTIPALFLIDKVGRRPVLLVGGIFMAIWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYS PAPGGV GDDTVTIQIPS+ +SAA GVIASSYLFVC FAPTWGIGIWIYCSE
Sbjct  361  GILATYSEPAPGGVGGDDTVTIQIPSDKSSAAKGVIASSYLFVCSFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSA+SAATNWAFNFALAMFVPSAFKNISWKTYI+FGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSAVSAATNWAFNFALAMFVPSAFKNISWKTYIVFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ET+GKTLEEIDQMW DNIPAW+T +YIPQLPI++DEEGNKLGLLG PQHLE+  SNEKGL
Sbjct  481  ETRGKTLEEIDQMWTDNIPAWKTGSYIPQLPIMEDEEGNKLGLLGRPQHLEEARSNEKGL  540

Query  541  LDRSDSASNSN  551
            +D SDS +NSN
Sbjct  541  IDHSDSNTNSN  551


> KLAEg360 KLAEg360 undefined product 785500:787164 forward MW:61058
Length=555

 Score =  967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/543 (83%), Positives = 507/543 (94%), Gaps = 0/543 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            MSL + LL R++QYEG FYKKFP +YNIYVIG IACISG+MFGFDI+SMSSMIGT VYKD
Sbjct  1    MSLIDLLLFRNVQYEGKFYKKFPQIYNIYVIGVIACISGMMFGFDISSMSSMIGTQVYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YF +PDSLT GGITASMAGGS LGSLISPNFSDA+GRKVS+H+C+ALWIIGAILQCAAQD
Sbjct  61   YFDSPDSLTQGGITASMAGGSLLGSLISPNFSDAYGRKVSMHVCSALWIIGAILQCAAQD  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            QAMLIVGRVISGMGIGFGSS+APVYC+E++PPKIRG ISGLFQFSVT+GIM+LF+IGYGC
Sbjct  121  QAMLIVGRVISGMGIGFGSSSAPVYCAEVAPPKIRGLISGLFQFSVTIGIMILFFIGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFI+GAAAFR+TWGLQ+VPGL+L+VG+FF+PESPRWLANHDRW+ET  IVANI ANGD+ 
Sbjct  181  HFINGAAAFRVTWGLQIVPGLVLLVGLFFVPESPRWLANHDRWDETRTIVANIAANGDIE  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            +EQV FQL+EIKEQV+ID AAKNF YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  DEQVIFQLDEIKEQVLIDEAAKNFSYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAG+TGNTNL++S+IQYVLNV+MTIPALFLIDK GRRP+LI+GGI MF+WLF+VA
Sbjct  301  VYIFNMAGFTGNTNLISSAIQYVLNVIMTIPALFLIDKVGRRPLLIVGGILMFSWLFAVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            G+LATYSVP PGGV+GD TV I+IP  + SAANGVIA SYLFVC FAPTWG+GIWIYCSE
Sbjct  361  GLLATYSVPVPGGVDGDTTVNIRIPDSSKSAANGVIACSYLFVCSFAPTWGVGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSALS ATNWAFNFALAMFVPSAF+NISWKTYIIFGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSALSTATNWAFNFALAMFVPSAFRNISWKTYIIFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ET+GKTLEEIDQMW DNIPAW+T++Y+PQLP+++DEEG+KLG++GN QHLE   S EK L
Sbjct  481  ETRGKTLEEIDQMWADNIPAWKTSSYVPQLPVLEDEEGHKLGVMGNAQHLEYNKSTEKAL  540

Query  541  LDR  543
            L++
Sbjct  541  LEK  543


> KLWIg101 KLWIg101 undefined product 216469:218493 forward MW:74992
Length=675

 Score =  244 bits (622),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 150/473 (32%), Positives = 248/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K +F NP + T G + + +  G+ + SL+
Sbjct  111  LYFTSVFVSLGVFLFGYDQGVMSGIITGPHFKVFFDNPSAATIGAMVSILEIGALVSSLL  170

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              N  + FGR+ ++   + ++I+G ++Q  +    +LI GRVISG+G+G  S+  P+Y S
Sbjct  171  VTNIGEKFGRRFTIKYGSLIFIMGGLVQTFSWKMDLLIAGRVISGIGVGLLSTIVPIYQS  230

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ Y C FI+   ++R+   +Q V GL+L +G 
Sbjct  231  EISPPHNRGKLACIEFTGNIVGYATSVWVDYACSFIESNTSWRLPLFIQCVMGLLLFLGS  290

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ +NGDV +     + + IKE V+I   ++  G K
Sbjct  291  FVIVETPRWLLNHDHDIEGLVVIADLHSNGDVLDSAAHQEYKLIKETVLI---SRLEGEK  347

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  348  KSIRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWLGREALLMTGINAII  407

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             V+ TI    L+DK+GR+P+L+ G + M T L S++  L          VNG  T  +  
Sbjct  408  YVISTIFPWKLVDKWGRKPILLSGALVMGTALLSISISL---------WVNGTYTPRL--  456

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI     R+  ++ S ATNW FN+ 
Sbjct  457  ----------VVIFVIIFNAFFGYSWGPIPWLYPVEIAPMTVRSAMASASTATNWLFNWL  506

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I WK Y+I              ++PET G  LE++D ++ D 
Sbjct  507  VGIMTPILQEKIHWKLYLIHATSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  559


> KLAEg1547 KLAEg1547 undefined product 3264612:3266621 forward 
MW:74137
Length=670

 Score =  237 bits (604),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/470 (30%), Positives = 239/470 (51%), Gaps = 21/470 (4%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K  F++P + T G + + +  G+ + SL+
Sbjct  104  LYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKAAFNDPSAATIGNMVSILEIGALVSSLL  163

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
                 + FGR+ ++   + ++I+G + Q  AQ  + L++GR+ISG+G+G  S+  P+Y S
Sbjct  164  VSKIGEKFGRRFTIKYGSLIFIVGGLGQTFAQKMSHLVLGRIISGVGVGLLSTIVPIYQS  223

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ Y C FI    ++R+   +Q + G +L  G 
Sbjct  224  EISPPHNRGKLACIEFTGNIVGYASSVWVDYACSFIQSNMSWRLPLFIQCIMGSLLFAGS  283

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ +NGDV +     + + IKE V+I          
Sbjct  284  FVIVETPRWLLNHDHDVEGLVVIADLHSNGDVVDVDAHQEYKMIKEAVLISRLEGEKKSI  343

Query  268  DLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
                K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++ V+
Sbjct  344  PFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWIGREALLMTGINSIIYVI  403

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
             TI    L+DK+GR+P+L+ G I M   L +                     ++I + S 
Sbjct  404  STIFPWKLVDKWGRKPILMSGAIIMGISLVA---------------------ISISLWSN  442

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
            ++     V+    +F  FF  +WG   W+Y  EI     R+  ++ S ATNW FN+ + +
Sbjct  443  HSYTPKLVVLFVIIFNAFFGYSWGPIPWLYPVEIAPMTARSAMASASTATNWLFNWLVGI  502

Query  448  FVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
              P   + I WK Y+I            F +FPET G  LE++D ++ D 
Sbjct  503  MTPILQEKIHWKMYLIHATSCFLSFWVVFRVFPETAGLRLEDMDSVFDDR  552


> KLDOg2691
Length=681

 Score =  237 bits (604),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 143/473 (31%), Positives = 248/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K +F+NP +   G + + +  G+ + SL+
Sbjct  118  LYFTSVFVSLGVFLFGYDQGVMSGIITGPYFKTFFNNPSAAAIGTMVSILEIGALVSSLL  177

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              +  + FGR+ ++   +A++I+G ++Q  + D   LI GR+ISG+G+G  S+  P+Y S
Sbjct  178  VSSIGEKFGRRFTIKYGSAIFIVGGLIQTFSWDMGCLIFGRIISGIGVGLLSTIVPIYQS  237

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ YGC +I+   ++R+   +Q V GL+L +G 
Sbjct  238  EISPPHNRGKLACIEFTGNIVGYATSVWVDYGCSYIESNTSWRLPLFIQCVMGLLLFLGS  297

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ ++GDV + +   +   IKE V+I   ++  G K
Sbjct  298  FVIVETPRWLLNHDHDVEGLVVIADLHSDGDVQDSKAHEEYRLIKETVLI---SRLEGEK  354

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  355  KSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSII  414

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             ++ TI    L+DK+GR+P+L+ G + M T L +++  L       P             
Sbjct  415  YIMSTILPWRLVDKWGRKPILLSGALVMGTSLLAISLSLWANIAATP-------------  461

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI  +  R+  ++ S ATNW FN+ 
Sbjct  462  --------RLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPSSARSAMASASTATNWLFNWL  513

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I W+ Y+I  V           ++PET G  LE++D ++ D 
Sbjct  514  VGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  566


> KLWIg3660 KLWIg3660 undefined product 7419975:7422182 forward 
MW:80999
Length=736

 Score =  227 bits (578),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 157/506 (32%), Positives = 259/506 (52%), Gaps = 47/506 (9%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITAS-----MAGGSFLG  84
            ++G    + G +FG+D   ++++      K +F+ P+ + +     S     ++ G+F G
Sbjct  81   LVGAFVAVGGFLFGYDTGLINNITEMPYVKAHFA-PNKVQFTPTQTSILVSFLSLGTFFG  139

Query  85   SLISPNFSDAFGRKVSLHICAA-LWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            +LI+P  SD++GRK ++ I    +++IG  LQ +A    +L+VGRV+SG+ +G  S+  P
Sbjct  140  ALIAPIISDSYGRKATVVISTFFVFMIGNSLQVSAHAMPLLVVGRVLSGVSVGLISAVVP  199

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            +Y SE +   +RG I   +Q+++T G++V   +  G H    A+++RI  GLQ V  LIL
Sbjct  200  LYQSEAAQKSVRGAIISTYQWAITWGLLVASAVSQGTHQRKDASSYRIPIGLQYVWALIL  259

Query  204  MVGVFFIPESPRWLANHDRWE--ETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
              G+ F+PESPR+    D+ +    SL     V   D     +  +L EIK     + + 
Sbjct  260  GTGILFLPESPRYYVLKDKLDLAAKSLSFLRGVPEDD---SALLEELVEIKATYDYERSF  316

Query  262  KNFGYKDLFRK-----KTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
             N  Y D FR      K   + + G++ Q +QQ  G+N + YY V  F+  G +G  + +
Sbjct  317  GNLSYLDCFRSSRSRAKQKLRMLTGIALQAFQQFSGINFIFYYGVNFFSKTGVSG--SYL  374

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
             S I Y +NV+  IP LFL++  GRR +L+ GG+ M    F +A +         G V  
Sbjct  375  VSFITYAVNVIFNIPGLFLVEYIGRRNLLLSGGVVMTISNFIIAIV---------GCVT-  424

Query  377  DDTVTIQIPSENTSAANGV-IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                       N+  AN V IA   LF+  F+ TWG G+W+  +E++    RAK +A+ A
Sbjct  425  -----------NSVVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICA  473

Query  436  ATNWAFNFALAMFVP------SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            A+NW  NF  A   P      S   ++  K + I+G  +    +  +F   ET G TLEE
Sbjct  474  ASNWLVNFICAFITPYLVDTGSHTSSLGTKIFFIWGSLNAMGVVTVYFTVYETSGLTLEE  533

Query  490  IDQMWVDNIPAWRTANYIPQLPIVKD  515
            ID++++ +  A  ++ +  +L    D
Sbjct  534  IDELYMKSSSAMTSSKWNKELRKAAD  559


> KLDOg4734
Length=583

 Score =  225 bits (574),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 159/543 (30%), Positives = 256/543 (48%), Gaps = 57/543 (10%)

Query  41   MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFLGSLISPNF  91
            +FG+D   MS +I    + D F      S+ D   ++  G +T+    G F GSL     
Sbjct  37   LFGYDQGLMSGIITGVRFNDEFPGTKERSDNDRHATVVQGAVTSCYELGCFFGSLFVMMR  96

Query  92   SDAFGRKVSLHICAA-LWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGSSAAPVYC  146
             +  GRK  L IC A L IIGA++  AA          ++GRVI+G+G G  +S  PV+ 
Sbjct  97   GERMGRK-PLIICGAILTIIGAVISTAAFGNHWGLGQFVIGRVITGLGTGMNTSTIPVWQ  155

Query  147  SEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVG  206
            SE+S P+ RG +  L    + VG M+ ++I +G  ++D +  +R    +Q+   ++L+VG
Sbjct  156  SEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFAILLLVG  215

Query  207  VFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGY  266
            +  +P+SPRWL    R EE   ++  +  N +  ++QV  +   I++ V      K    
Sbjct  216  ILQLPDSPRWLVAQGRREEAMYVLGKL-DNLEPTDDQVMAEYTSIQDAVNRFKHQKR-SL  273

Query  267  KDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNLVASSIQY  322
            K+L    + + L + ++  S Q +QQ  G N  +YY   +F    G     +L+   +  
Sbjct  274  KELLHGGKGQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFKKTIGLEDRLSLILGGVFS  333

Query  323  VLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTI  382
             +  + TIP+ FLI+  GRR + ++G              L T++               
Sbjct  334  TIYALSTIPSFFLIETLGRRKLFLLGA------FGQGCSFLITFAC--------------  373

Query  383  QIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFN  442
             +  + T+ A G     +LF+ FF  +     WIY  EI +   R+  +A S  TNW  N
Sbjct  374  -LVHDTTANAKGAAVGLFLFIVFFGMSILSLPWIYPPEIASTRVRSVTNAFSTCTNWLCN  432

Query  443  FALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----QMWVDNI  498
            FA+ MF P   ++  W  Y+ F   +       FF +PET G++LEEID    + + D  
Sbjct  433  FAVVMFTPIFIQDAGWGCYLFFACVNFLYLPVIFFFYPETAGRSLEEIDIIFAKAYTDKT  492

Query  499  PAWRTANYIPQLPIVK-DEEGNKLGLLGNPQHLEDVHSNEK----------GLLDRSDSA  547
            PAWR A  +P+L + + ++ GN LGL  +    ED   N+            L  R  SA
Sbjct  493  PAWRVAANLPKLSLSEIEDHGNALGLYDDDLEKEDELDNDSLNKEQPHPGFSLFQRKKSA  552

Query  548  SNS  550
            +N+
Sbjct  553  ANA  555


> KLWIg1971 KLWIg1971 undefined product 4071237:4072655 reverse 
MW:52739
Length=473

 Score =  219 bits (557),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 135/453 (30%), Positives = 234/453 (52%), Gaps = 28/453 (6%)

Query  45   DIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHIC  104
            D +S+S  +G + +K YF  P++L  G +TA+   G FLG L+S    ++ G + SL +C
Sbjct  2    DTSSLSLFLGAEYFKRYFKFPNALHTGMMTAANQIGGFLGCLLSGVIIESIGCRWSLCLC  61

Query  105  AALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQF  164
              +W  G+I      +   + +GR++ G+ +G  S  A  Y  E+    IRG  + L Q 
Sbjct  62   GIVWTTGSIGSIFVAEVYTMALGRLVKGLSVGILSVLASFYLMEVFSSNIRGQATALLQM  121

Query  165  SVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWE  224
            ++T+ I+ ++++      I  + AF+ITWG++ +P ++L+V    +PESPRWL+ H+  E
Sbjct  122  ALTMSILAIYFLSLSLDRIQNSLAFKITWGVETLPSVLLLVLFKALPESPRWLSKHNCTE  181

Query  225  ETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS-AAKNFGYKDLFRKKTLPKTIVGVS  283
            E      NI+   D+         E+ KE+V +DS    +  +  + RK      ++G+S
Sbjct  182  EQIKKSLNIIKVTDI---------EKFKEKVSVDSNQVPSISF--IIRKGYWKHVLLGIS  230

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP  343
             Q+  QL G+NV+MYY+VYI  M G+    +   ++  Y++NV+ T+  +FL+DKF R+ 
Sbjct  231  VQVLIQLSGINVIMYYMVYICEMVGFDEEISSKLTAGPYIVNVLFTLIPVFLLDKFNRK-  289

Query  344  VLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFV  403
            V I    F+   +    G+L        G V                  N VI+  +LFV
Sbjct  290  VFIGWASFLLGTIMLTVGVLIGERERHLGDV---------------IIRNIVISLCFLFV  334

Query  404  CFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYII  463
              FA +     ++Y +EI     ++   ++  +T+W   F LA+  P   + + W T+II
Sbjct  335  SVFASSLSCAGFVYTNEILPESIKSVALSVCISTSWLSGFVLALMTPKLMQLVEWWTFII  394

Query  464  FGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD  496
             G+ ++ ++      FPETKG + +EI+ ++ D
Sbjct  395  LGISTITMSFIIIIWFPETKGLSPDEINDLFDD  427


> KLAEg4033 KLAEg4033 undefined product 8552313:8554025 forward 
MW:62907
Length=571

 Score =  213 bits (543),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 148/512 (29%), Positives = 242/512 (48%), Gaps = 57/512 (11%)

Query  41   MFGFDIASMSSMIGTDVYKDYFSNPDS---------LTYGGITASMAGGSFLGSLISPNF  91
            +FG+D   MS +I    + D F    S         +  G +T+    G F GSL     
Sbjct  35   LFGYDQGLMSGIITGTQFNDEFRATKSTGDNDRHATVVQGAVTSCYELGCFFGSLFVMFR  94

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGSSAAPVYCS  147
             +  GRK  + + A L IIG ++  AA          ++GRVI+G+G G  +S  PV+ S
Sbjct  95   GEKIGRKPLVMVGAVLTIIGTVISTAAFGPQWGLGQFVIGRVITGIGTGMNTSTIPVWQS  154

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            E+S P+ RG +  L    + +G M+ ++I +G  ++D +  +R     Q+   ++L++G+
Sbjct  155  EMSKPENRGLLVNLEGSVIAIGTMIAYWIDFGLSYVDSSVQWRFPVAFQIFFAILLLIGM  214

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGY-  266
              +P+SPRWL +  R EE +L V   + N D +++Q+      I E  +I  A   F + 
Sbjct  215  IGLPDSPRWLISQGRREE-ALYVLGKLDNLDPSDDQI------IAEATVIQDAVNRFKHQ  267

Query  267  ----KDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIF-NMAGYTGNTNLVAS  318
                KDL+   + +   + +V  S Q +QQ  G N  +YY   +F N  G      L+  
Sbjct  268  KHSIKDLWTGGKGQYFQRAMVAASTQFFQQFTGCNAAIYYSTVLFKNTIGLDDRLALILG  327

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
             +   +  + T+P+ FLI+  GRR +   G +                      G     
Sbjct  328  GVFSTVYAISTVPSFFLIETLGRRKLFFYGAL----------------------GQGISF  365

Query  379  TVTIQIPSENTSA-ANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
            T+T     +NT+  A G     +LF+  F  +     WIY  EI +   R+  +ALS  T
Sbjct  366  TITFGCLIDNTTQNAKGAAVGLFLFIICFGMSILSLPWIYPPEIASMRVRSVTNALSTCT  425

Query  438  NWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----QM  493
            NW  NFA+ MF P   +   W  Y+ F + +       +F +PET G++LEEID    + 
Sbjct  426  NWLCNFAVVMFTPIFVQQAGWGAYLFFALMNYLYLPVIYFFYPETAGRSLEEIDIIFAKA  485

Query  494  WVDNIPAWRTANYIPQLPIVK-DEEGNKLGLL  524
            ++D    WR A ++P+L + + +++GN LGL 
Sbjct  486  YIDKTLPWRVAEHLPKLTLSEVEDQGNALGLF  517


> KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward 
MW:84266
Length=762

 Score =  212 bits (539),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 150/527 (29%), Positives = 261/527 (50%), Gaps = 47/527 (8%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITAS-----MAGGSFLG  84
            ++G    + G +FG+D   ++++      K+ F+ P+   +     S     ++ G+F G
Sbjct  95   LVGIFVAVGGFLFGYDTGLINNVTEMPYVKETFA-PNGYQFTAEQMSILVSFLSLGTFFG  153

Query  85   SLISPNFSDAFGRKVSLHICAA-LWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            +L +P  SD +GRK ++      ++++G  LQ AA    +L++GRVISG+ IG  S+  P
Sbjct  154  ALTAPFISDTWGRKATVIFSTFFVFMVGNSLQVAATSMTLLVIGRVISGISIGLISAVVP  213

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            +Y  E +   +RG I   +Q+++T G++V   +  G      A+++RI  GLQ +   +L
Sbjct  214  LYQGEAALKSVRGAIISTYQWAITWGLLVASAVSQGTRSRPNASSYRIPIGLQYIWSFVL  273

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN  263
             +G+ F+PESPR+    D+ ++ +  ++ +    + ++  +  +L EIK     + +  N
Sbjct  274  GLGIIFLPESPRYYVLKDQLDKAAKSLSFLRGVPE-DDSGLLEELVEIKATYDYEMSFGN  332

Query  264  FGYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
              Y D F     R K   + + G++ Q +QQ  G+N + YY V  FN +G     +   S
Sbjct  333  LSYLDCFRSSKSRSKQRLRMLTGIAIQAFQQFSGINFIFYYGVNFFNKSGII--ESYTVS  390

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
             I Y +NV   IP LFL++  GRR +L+ GG+ M    F +A                  
Sbjct  391  LITYAVNVAFNIPGLFLVEYMGRRKLLLSGGVLMTISNFIIA------------------  432

Query  379  TVTIQIPSENTSAANGV-IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
               I   S N+  AN V IA   +F+  F+ TWG G+W+  +E++    RAK +A+ AA+
Sbjct  433  ---IVGSSTNSVVANNVMIAFICMFIASFSATWGGGVWVISAELYPLGVRAKCTAICAAS  489

Query  438  NWAFNFALAMFVPSAFK------NISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
            NW  NF  A+  P  F       ++  K + ++G  +   TI  +F   ET G TLE+ID
Sbjct  490  NWLINFICALMTPYLFDTGNHTTSLGTKIFFLWGSLNALGTIVVYFAVYETSGLTLEQID  549

Query  492  QMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEK  538
            +++  +     +  +  ++    D+   +   L   QH     S+EK
Sbjct  550  ELYQKSSSGINSRKWNKEIRNAPDQYHLRRKQLDELQH----ESHEK  592


> KLDOg1226
Length=497

 Score =  204 bits (518),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/472 (27%), Positives = 233/472 (50%), Gaps = 28/472 (5%)

Query  24   HVYNI-YVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
            H + +  +IG + CI G M G D +S+S  +GTD +K++F +P++L  G +T +   G +
Sbjct  3    HAFEVKRLIGLVVCI-GFMLGMDTSSLSLFLGTDYFKEFFDHPNALQTGMMTGANQIGGY  61

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
             G L S +  +  G K  L +C+ +W IG+I      +   + + R + G  +G  S  A
Sbjct  62   FGCLSSGSLIEYLGCKWCLCVCSIIWSIGSIGSVLVFEVYTMALSRFVKGFAVGILSVLA  121

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
              Y  E+    IRG  + L Q ++T+ I++++++      +    AF+I WGL+M+PGL+
Sbjct  122  SFYLMEVFSSNIRGQATALMQLALTISILLIYFLSMMLDRMKSPLAFKIVWGLEMIPGLL  181

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            L+V    +PESPRWL  H   +        I+   D +           +E+++++S  +
Sbjct  182  LVVLFQALPESPRWLHKHGYSKNHIDRSLKILRAKDTDT---------FREKLLLESKLQ  232

Query  263  NFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQY  322
                 D  +K        G+  Q+  Q+ G+NV+MYY++YI  + G+        ++  Y
Sbjct  233  P-NISDFIKKGYWKHMSFGILVQVLIQMSGINVIMYYMIYICEIIGFDEEIGSKLTAGPY  291

Query  323  VLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTI  382
            ++NV+ T+  +F++DKF R+  +    +F+   + S+ G+L        G V   + V  
Sbjct  292  IVNVIFTLIPVFMLDKFNRKVFIGWASLFLGCIMLSI-GLLIGERYRHVGDVVLRNIVVA  350

Query  383  QIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFN  442
                  +  ++ +  + +               +Y +EI  +  ++   ++  +TNW   
Sbjct  351  LCFLFVSVFSSSLSCAGF---------------VYTNEILPDSIKSVALSVCISTNWLTG  395

Query  443  FALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            F LA+  P   + + W T+ I G+ ++ L+I     FPETKG + EEID ++
Sbjct  396  FVLALVTPRLMQLVEWWTFFILGISTIVLSIVIICWFPETKGLSTEEIDNLF  447


> KLDOg2154
Length=567

 Score =  192 bits (489),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/481 (29%), Positives = 232/481 (49%), Gaps = 24/481 (4%)

Query  39   GLMFGFDIASMSSMIGTDVYKDYF--SNPDSLTY------GGITASMAGGSFLGSLISPN  90
            G +FG+D  ++S  +    +   F  ++ D   Y      G I +    G  +G +I   
Sbjct  75   GFVFGWDTGTISGFVNQTDFVRRFGQTHADGTHYLSNVRTGLIVSIFNIGCAVGGIILSK  134

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              D +GR++ L I   ++++G I+Q A+ D+     +GR+ISG+G+G  S  +P+  SE 
Sbjct  135  LGDMYGRRIGLMIVVLIYVVGIIIQIASIDKWYQYFIGRIISGLGVGGISVLSPMLISET  194

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
            +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL     + ++ G+ F
Sbjct  195  APKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMIAGMLF  254

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
            +PESPR+L      +E    +A       V +  V+ +++ I      +  A +  +K+L
Sbjct  255  VPESPRYLVEKHMIDEAKRSIAK-SNKVSVEDPAVQAEVDLICAGYEAEQLAGSASFKEL  313

Query  270  F--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
            F  + K L + I+G+  Q +QQL G N   YY   +FN  G   + +   S +  ++N  
Sbjct  314  FSVKTKVLQRLIMGIMIQSFQQLTGNNYFFYYGTTVFNSVGM--DDSFQTSIVLGIVNFA  371

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
             T  A+++++KFGRR  L+ G   M + +   A +  T   P      G D     I S+
Sbjct  372  STFIAIYVVEKFGRRRCLLWGAAAMTSCMVVFASVGVTRLWP-----EGPDA---GISSK  423

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
                   V A  Y+F   FA +W    ++  +E +    +AK  AL+ A+NW + F +  
Sbjct  424  GAGNCMIVFACFYIFC--FATSWAPIAYVVVAESYPLRVKAKCMALATASNWVWGFLIGF  481

Query  448  FVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYI  507
            F P     I +    +F    VA+    F   PETKG TLEE+ +MW + +  W+++ +I
Sbjct  482  FTPFITSAIHFYYGYVFMGCLVAMFFYVFIFVPETKGLTLEEVQEMWEEGVLPWKSSTWI  541

Query  508  P  508
            P
Sbjct  542  P  542


> KLAEg2136 KLAEg2136 undefined product 4520230:4521936 reverse 
MW:63066
Length=569

 Score =  191 bits (484),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 147/518 (29%), Positives = 248/518 (48%), Gaps = 48/518 (9%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY------GGITASM  77
            YV   I C+     G +FG+D  ++S  +  TD  + + S     +Y       G+  S+
Sbjct  63   YVFVSICCVMVAFGGFVFGWDTGTISGFVNQTDFIRRFGSQHSDGSYYLSNVRTGLMVSI  122

Query  78   AG-GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGI  135
               G  +G +I     D +GR++ L     ++++G I+Q A+  +     +GR+ISG+G+
Sbjct  123  FNIGCAIGGIILSKLGDTYGRRIGLMAVVTIYVVGIIIQIASVSKWYQYFIGRIISGLGV  182

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL
Sbjct  183  GGITVLSPMLISETAPKHLRGTLVSCYQLMITCGIFLGYCTNYGTKTYSNSVQWRVPLGL  242

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKE  253
                 L ++ G+ F+PESPR+L   +R EE   SL   N VA   +++  V  +L  I+ 
Sbjct  243  CFAWALFMIGGMVFVPESPRYLVEVNRTEEARASLAKTNKVA---LDDPVVNVELSRIEA  299

Query  254  QVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
             V  +  A +  + +L   K   L +T +G+  Q  QQL G N   YY   IF   G   
Sbjct  300  SVEAEKLAGSASWGELLTGKPAMLRRTTMGIMIQSLQQLTGDNYFFYYGTTIFQAVGL--  357

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPA-  370
              +   + +  ++N   T  +L+ +DKFGRR  L+ G I          G++A Y V A 
Sbjct  358  EDSFETAIVLGIVNFASTFFSLYTVDKFGRRKCLLWGCI----------GMIACYVVYAS  407

Query  371  -------PGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFN  423
                   P GV+ D T        +  A N +I  +  ++  FA TW    ++  SE + 
Sbjct  408  VGVTRLWPEGVDSDVT--------SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYP  459

Query  424  NMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETK  483
               R K  A+++A NW + F ++ F P     I +    +F    V      FF  PETK
Sbjct  460  LRIRGKAMAIASAANWIWGFLISFFTPFITSAIHFYYGYVFMGCMVFAYFYVFFFVPETK  519

Query  484  GKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKL  521
            G TLEE+++M+ + + AW++++++P+     D + + L
Sbjct  520  GLTLEEVNEMYAEGVLAWKSSSWVPESRRGTDYDADAL  557


> KLAEg1384 KLAEg1384 undefined product 2927919:2929625 forward 
MW:61931
Length=569

 Score =  178 bits (451),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 158/563 (29%), Positives = 263/563 (47%), Gaps = 59/563 (10%)

Query  2    SLKNWLLLRDIQYEG------TFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSM---  52
            S ++ +LL+ +  E       TF +K      I ++   A ISG MFG+D   +SS    
Sbjct  32   SSRDRILLKPVNDEDDTSVMITFNQKMSPF--IIILTLTASISGFMFGYDTGYISSALVS  89

Query  53   IGTDVYKDYFSNPDSLTYGG---ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWI  109
            IGTD+ ++       LTYG    ITA+ + G+ + ++ S   SD FGRK  L +   L++
Sbjct  90   IGTDLGRE-------LTYGDKEIITAATSLGALISAIFSGVASDMFGRKTCLMVSNILFV  142

Query  110  IGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVG  169
            IGA LQ AA     +  GR++ G G+G GS  APV+ SEI+P  +RG ++ +    +T G
Sbjct  143  IGACLQVAAHSFWEMAAGRLVMGFGVGIGSLLAPVFISEIAPKHVRGRLTVINSLWLTGG  202

Query  170  IMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLI  229
             ++ + IG G   ++    +RI  GL ++P ++      F+P++PR+      +++ + +
Sbjct  203  QLIAYGIGAGLSNVNN--GWRILVGLSLIPTVLQFCCFLFLPDTPRFYVMTGNYKKAAEV  260

Query  230  VANIVANGDVNNEQVRFQLEEIKE--QVIIDSAAKNFGYKDLFRKKTLPKT----IVGVS  283
            +       D  +E +  ++EE+ +  Q +      +  +  +    T+P      I+G  
Sbjct  261  LQKSYV--DTPSELIDRKIEELADLNQSVPGKTPLHKAWNAVKLLHTVPSNFRALIIGCG  318

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP  343
             Q  QQ CG N +MY+   IF   G+  +T    S I    N V T+ A F IDK GRR 
Sbjct  319  LQGIQQFCGWNSLMYFSGTIFEAIGFENST--AVSIIVAGTNFVFTLVAFFCIDKIGRRT  376

Query  344  VLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFV  403
            +L+IG   M   L   A       +   GG         +I +   S+   VI +   F+
Sbjct  377  ILLIGLPGMMVSLVMCAIAFHFLDIKFQGGGQA------EIANGGFSSWGSVIVA---FI  427

Query  404  CFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS-W  458
              +A  + +GI    W   SE+F    R  G++   ATNWA +  +A    +  +NI+  
Sbjct  428  IIYAAFYALGIGTVPW-QQSELFPTPVRGVGTSFCTATNWAGSLVIASTFLTMLENITPT  486

Query  459  KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD--NIPAWRTANYIPQLPIVKDE  516
             T+ +F   +   T+  +  +PE  G  LEE+  +  D  NI A +      +  + + +
Sbjct  487  GTFALFAGLAAVSTLFCYLCYPELSGLELEEVQTILSDGFNIKASKQLAKKRKRQLKEQQ  546

Query  517  EGNKLGLLGNPQHLEDVHSNEKG  539
            E              D+ S++KG
Sbjct  547  EN---------LAQRDLESDQKG  560


> KLAEg2135 KLAEg2135 undefined product 4517129:4518817 reverse 
MW:62290
Length=563

 Score =  177 bits (449),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 137/505 (28%), Positives = 242/505 (48%), Gaps = 36/505 (7%)

Query  27   NIYVIGFIACISGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY------GGITASMAG  79
             + V+  +    G +FG+D  ++S  +  TD  + + S     +Y       G+  S+  
Sbjct  59   TVSVLCVMVAFGGFVFGWDTGTISGFVNQTDFIRRFGSQHSDGSYYLSDVRTGLMVSIFN  118

Query  80   -GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G ++     D  GR++ L +   ++++G I+Q A+  +     +GR+ISG+G+G 
Sbjct  119  IGCAIGGIVLSKLGDTHGRRIGLMVVVVVYVVGIIIQIASVSKWYQYFIGRIISGLGVGG  178

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             S  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL  
Sbjct  179  ISVLSPMLISETAPKHLRGTLISCYQLMITCGIFLGYCTNYGTKTYSNSVQWRVPLGLCF  238

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQV  255
               L ++ G+ F+PESPR+L   D+  E   S+  +N V+   V++  V+ +L+ I   V
Sbjct  239  AWALFMIGGMVFVPESPRYLVEKDQLSEAKRSIARSNKVS---VDDPSVQLELDLIAAGV  295

Query  256  IIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
              +  A +  + +LF  + K   + I+G+  Q  QQL G N   YY   IF   G T   
Sbjct  296  EAERLAGSASWGELFSTQTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKSVGMT--D  353

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVPAP  371
            +   S +  ++N   T  A++ +D FGRR  L+ G   M   +  F+  G+   +     
Sbjct  354  SFETSIVLGIVNFASTFFAIYTVDNFGRRKCLLWGAAGMTACMVVFASVGVTRLWPEGKS  413

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
             G++            +  A N +I  +  ++  FA TW    ++  +E +    +AK  
Sbjct  414  AGIS------------SKGAGNCMIVFACFYIFCFATTWAPTAYVVIAESYPLRVKAKCM  461

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            AL+ A+NW + F ++ F P     I+ +  Y+  G          FF+ PETKG TLEE+
Sbjct  462  ALATASNWIWGFLISFFTPFITSAINFYYGYVFMGCLVFMYFYVFFFV-PETKGLTLEEV  520

Query  491  DQMWVDNIPAWRTANYIPQLPIVKD  515
              MW + +  W++A ++P  P  +D
Sbjct  521  QMMWEEGVLPWKSAEWVP--PSRRD  543


> KLDOg3633
Length=569

 Score =  175 bits (443),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 144/495 (30%), Positives = 243/495 (50%), Gaps = 43/495 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I ++ F A ISG MFG+D   +SS    IGTD+      +  +LTYG    ITA+ + G+
Sbjct  61   ILILTFTASISGFMFGYDTGYISSALVSIGTDL------DGKTLTYGDKEIITAATSLGA  114

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + ++ +   +D FGRK  L     L+++GA LQ +A     + +GR+I G G+G GS  
Sbjct  115  LISAIFAGISADIFGRKPCLMFSNVLFVVGAALQVSAHSFWQMTIGRLIMGFGVGIGSLL  174

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  175  APLFISEIAPKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHN--GWRILVGLSLIPTV  232

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVAN--IVANGDVNNEQVRFQLEEIKEQVIIDS  259
            +      F+P++PR+      +E+ + ++    I A  D+  +++R +L ++ E +   +
Sbjct  233  VQFTCFAFLPDTPRFYVMKGEYEKAACVLQKSYINAPSDLIEQKIR-ELTQLNEAIPGKN  291

Query  260  AAKNFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
                  +  +    T+P      ++G + Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  292  PVHKL-FNTVKELHTVPSNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENST--  348

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N V T+ A F IDK GRR +L+IG   M   L   A      ++   G   
Sbjct  349  AVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLNIKFTGA--  406

Query  376  GDDTVTIQIPSENTSAAN-GVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKG  430
            G   V      EN   ++ G++    +F+  +A  + +GI    W   SE+F    R  G
Sbjct  407  GSSQV------ENGGFSSWGIVV--IVFIMVYAAFYALGIGTVPW-QQSELFPTSVRGVG  457

Query  431  SALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            ++   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +  +PE  G  LEE
Sbjct  458  TSFCTATNWAGSLIIASTFLTMLQNITPTGTFSLFAALAAVSTVFCYLCYPELSGLELEE  517

Query  490  IDQMWVD--NIPAWR  502
            +  +  D  NI A +
Sbjct  518  VQTILSDGFNIKASK  532


> KLDOg2155
Length=565

 Score =  172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/500 (28%), Positives = 242/500 (49%), Gaps = 38/500 (7%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYK----------DYFSNPDSLTYGGI  73
            YV   I C+     G +FG+D  ++S  +  TD  +           Y SN   +  G I
Sbjct  60   YVTVAILCLFVAFGGFVFGWDTGTISGFVNQTDFVRRFGQTRHDGSHYLSN---VRTGLI  116

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISG  132
             +    G  +G ++     D +GR++ L +   ++I+G I+Q A+ D+     +GR+ISG
Sbjct  117  VSIFNIGCAVGGIVLSRLGDVYGRRIGLMVVVIIYIVGIIIQIASIDKWYQYFIGRIISG  176

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            +G+G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+ 
Sbjct  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236

Query  193  WGLQMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEE  250
             GL     + ++ G+ F+PESPR+L  + + EE   SL   N V+   +++  VR++L  
Sbjct  237  LGLCFAWAIFMIAGMVFVPESPRFLVENGKVEEAKRSLAKTNKVS---LDDPVVRYELLH  293

Query  251  IKEQVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAG  308
            I+    ++ AA +  + +L   K     +T++G+  Q  QQL G N   YY   IFN  G
Sbjct  294  IQSSYEMEKAAGSASWGELVTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFNAVG  353

Query  309  YTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV  368
               + +   S +  ++N   T  AL+ +DKFGRR  L+ G            G++A Y V
Sbjct  354  M--DDSFETSIVLGIVNFASTFFALYTVDKFGRRKCLLWGA----------TGMVACYVV  401

Query  369  PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
             A  GV             +  A N +I  +  ++  FA TW    ++  SE +    + 
Sbjct  402  YASVGVTKLWPEGPDAGVSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKG  461

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLE  488
            K  ++++A NW + F +  F P     I +    +F    V      +F  PETKG TLE
Sbjct  462  KAMSIASAANWVWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLE  521

Query  489  EIDQMWVDNIPAWRTANYIP  508
            E+++M+ + +  W++++++P
Sbjct  522  EVNEMYQEGVLPWKSSDWVP  541


> KLWIg1461 KLWIg1461 undefined product 2953274:2954977 forward 
MW:61844
Length=568

 Score =  168 bits (425),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 144/498 (29%), Positives = 233/498 (47%), Gaps = 49/498 (9%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I V+ F A ISG MFG+D   +SS    IGTD+      +   LTYG    ITA+ + G+
Sbjct  60   ILVLTFTASISGFMFGYDTGYISSALVSIGTDL------DGKLLTYGDKEIITAATSLGA  113

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + +L +   +D  GRK  L     L++IG  LQ  A     +  GR++ G G+G GS  
Sbjct  114  LISALFAGIAADMVGRKPCLMFSNVLFVIGGGLQIGAHTFWQMAAGRLLMGFGVGIGSLL  173

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  174  APLFISEIAPKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHN--GWRILVGLSLIPTV  231

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIK--EQVIIDS  259
            I      F+P++PR+      +E+ + ++     N    ++ +  ++EE+      +   
Sbjct  232  IQFTCFLFLPDTPRYYVMKGEYEKAAKVLQRSYVNAP--SDLIEKKIEELAALNHAVPGK  289

Query  260  AAKNFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
               +  +  + +  T+P      I+G   Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  290  NPVHKAWNTIKQLHTVPSNFRALIIGCGLQGIQQFCGWNSLMYFSGTIFQSVGFENST--  347

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N + TI A F IDK GRR +L+IG   M   L   A      ++   GG  
Sbjct  348  AVSIIVAGTNFIFTIVAFFAIDKVGRRAILLIGLPGMMVSLVMCAVAFHFLNIKFVGG--  405

Query  376  GDDTVTIQIPSENTSAANGVIAS----SYLFVCFFAPTWGIGI----WIYCSEIFNNMER  427
                         T  +NG  +S      +F+  +A  + +GI    W   SE+F    R
Sbjct  406  -----------GQTEISNGGFSSWGIVVIVFIMVYAAFYALGIGTVPW-QQSELFPTSVR  453

Query  428  AKGSALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKT  486
              G++   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +F +PE  G  
Sbjct  454  GVGTSYCTATNWAGSLIIASTFLTMLENITPTGTFSLFAGLAAVSTVFCYFCYPELSGLE  513

Query  487  LEEIDQMWVD--NIPAWR  502
            LEE+  +  D  NI A +
Sbjct  514  LEEVQTILSDGFNIKASK  531


> KLWIg4168 KLWIg4168 undefined product 8462108:8463787 forward 
MW:62337
Length=560

 Score =  165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 147/535 (28%), Positives = 244/535 (46%), Gaps = 46/535 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDSLTYGGITASMAG-----GS  81
            +Y +  I      M GFD + M S+   + Y DY+  + +S T  G+  S+       G+
Sbjct  57   LYSMCLIVYFCSTMQGFDGSLMGSIYTMEDYLDYYDLDINSSTGTGLVFSIYNIGQICGA  116

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
            F  SL+     D  GRK+++ +     ++GA++  A   +  LI GR          +SA
Sbjct  117  FFCSLM-----DWKGRKIAILVGCTGAVVGAVITGATSTRGGLIGGRWFLSFFATIANSA  171

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMV-  198
            AP YC E++PP +RG ++GL+     VG +   +  YG   H    + +F+I   +QMV 
Sbjct  172  APTYCVEVAPPHMRGKVAGLYNTLWYVGSLTAAFTTYGTNKHLAGTSKSFKIPLYVQMVF  231

Query  199  PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIID  258
            PG++ + G + IPESPRWL    R EE    +       D N+  +  ++ E+ E    +
Sbjct  232  PGIVAIFG-WLIPESPRWLVGVGREEEARKFIVKYHCGNDENHPLIDIEMAEMIESFKSN  290

Query  259  SAAKNFGYKD---LFRKKTLPKTIVGVSAQMW-QQLCGMNVMMYYIVYIFNMAGYTG-NT  313
            + +      D   LFR K+    +  + A  W  Q  G NV  YY+  +    G T  +T
Sbjct  291  NLSDPLTVIDVRPLFRTKSDRYRLGLIVAMAWFGQFSGNNVCSYYLPTMLTKVGMTSVST  350

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGG  373
            N++ + +  +++ V ++   F  DK GRR       +FMF+ L +   +       A   
Sbjct  351  NVLMNGVYSIVSWVSSVLGSFAHDKVGRRK------MFMFSTLGAALALTGLAICTARYE  404

Query  374  VNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
            VNG D            A+ G +   YLF   F+  +     IY SE+ +N+ R+K   +
Sbjct  405  VNGSD-----------GASKGTLVFIYLFGVIFSFAFTPMQPIYPSEVASNLIRSKAQFV  453

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
               T+    F      P A +NI +  Y+ +  F +   +  +F F ETKGKTLEE++ +
Sbjct  454  LNVTSGVAQFVNQFAAPKAMQNIRYWFYVFYVFFDIFEFVIIYFFFVETKGKTLEELEAV  513

Query  494  WVDNIPAWRTANYIPQLPI-VKDEEGNKLGLLGNPQHLEDVHSNEKGLLDRSDSA  547
            +    P  R A+  P     ++   G +       +H++D+H   +     S+SA
Sbjct  514  F--EAPNPRKASTDPNFAADIRLTSGYE------AEHMKDLHLKAETEHLESESA  560


> KLAEg1845 KLAEg1845 undefined product 3943115:3944440 reverse 
MW:49037
Length=442

 Score =  158 bits (400),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/415 (26%), Positives = 202/415 (49%), Gaps = 32/415 (7%)

Query  71   GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVI  130
            G +T++   G F G LIS    +  G K  L +C  +W +G+     A +   L   R++
Sbjct  2    GLVTSASQVGGFFGCLISGAVIEFLGCKWGLCLCGIIWNVGSFGAIFALEVNSLAFTRLL  61

Query  131  SGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFR  190
             G+ IG  S  A  Y  ++    IRG  + L Q ++T  I+++++I      +    +F+
Sbjct  62   KGISIGILSVLASFYVMDVFSSNIRGQATALLQVALTTSILLVYFISMLLDGLKRPLSFK  121

Query  191  ITWGLQMVPGLILMVGVFFIPESPRWL---ANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            +TWG++++P + L+   +F+PE+P WL    N ++  + SL +  +      N ++++  
Sbjct  122  LTWGIEVIPAISLLFIAYFLPEAPCWLIKKCNSEKELDRSLDIIKV-----KNKKRLKEH  176

Query  248  LEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA  307
            L +  ++V+  S+        LF+       I G S Q+  Q+ G+NV+MYY+VYI ++ 
Sbjct  177  LSQKYKEVVTTSS--------LFKSGNWCHLIFGTSVQILIQMSGINVIMYYMVYICDIL  228

Query  308  GYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYS  367
            G+  +T    ++  Y++NV+ T+   FL+DKF R+  +    + + T +  +      + 
Sbjct  229  GFDDDTAFNLTAGPYIVNVLFTVVPFFLMDKFPRKVFVGWSSLLLGTIMLGIG-----FL  283

Query  368  VPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMER  427
            +       GD  +            N V+A   LFV  FA + G   ++Y +E+     +
Sbjct  284  IYERQKYVGDVVIR-----------NVVVALCLLFVSIFASSLGCAGFVYTNELLPEDMK  332

Query  428  AKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPET  482
            + G ++  +  W   F LA+  P    +I + T++I G  ++ +++     FPET
Sbjct  333  SFGLSICISMGWLSGFVLALLAPKMINSIGYWTFLILGSVTMVMSVVIIIWFPET  387


> KLAEg2614 KLAEg2614 undefined product 5530065:5531768 forward 
MW:62815
Length=568

 Score =  158 bits (399),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 141/497 (29%), Positives = 235/497 (48%), Gaps = 42/497 (8%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDS  67
            L+ +++    +KK  ++  + ++G  A  +G++ G D + +S + IG     D  S  DS
Sbjct  77   LKRMEFMQVEFKKKKNM--VIMLGVFASFAGILSGIDQSIISGASIGMKKSLDLTSTQDS  134

Query  68   LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVG  127
            L    I++ M  G+  GS++    S+  GRKV+L +    + +GAIL  AAQD   +  G
Sbjct  135  L----ISSLMPLGAVGGSILLTPLSEYLGRKVALVVSCIFYTVGAILCAAAQDHNTMYAG  190

Query  128  RVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA  187
            R + G+G+G       VY +E  P  +RG++  L+QF++ +G +  + I  G  F D   
Sbjct  191  RFLLGVGVGIEGGGVGVYIAESVPSTVRGSLVSLYQFNIALGELFGYII--GVIFFDVTG  248

Query  188  AFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
             +R   G  +V   +L++G+ F+PESPRWLA+     E   +   +    D+ N+    +
Sbjct  249  GWRFMVGSSLVFSTVLLIGLLFLPESPRWLAHKGYTAEAYQVWTRLREASDIKNKWEFLE  308

Query  248  LEEIKEQ--VIIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIV  301
            ++   EQ   +  S +K     DLF     ++ L  +I+ VS     QL G+N +MYY+ 
Sbjct  309  MKHAAEQDEELRRSESKFKSLFDLFLIARNRRALIYSIMMVS---LGQLTGINAIMYYMS  365

Query  302  YIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAG  361
             +    G+    ++  S +     ++ TIPA+  +D+FGRRP           W  ++ G
Sbjct  366  TLMGQIGFDDKQSVAMSMVGGAALLLGTIPAILYMDRFGRRP-----------WSMTIIG  414

Query  362  ILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEI  421
             +    +   G     DT        N +AA GV  +  +    F  T+    W+  SE 
Sbjct  415  FIIGLVLVGIGYHINIDT--------NLAAAEGVYLTGQILYNMFFGTYATLTWVVPSES  466

Query  422  FNNMERAKGSALSAA--TNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTI--QTFF  477
            F+   R+ G  + +A    WAF          A    +  T   +G  ++ + I  Q  F
Sbjct  467  FSLATRSIGMTICSAFLYLWAFTVTYNFNRMQAAFTYTGLTLGFYGGIAIVIGIPYQLLF  526

Query  478  MFPETKGKTLEEIDQMW  494
            M PETK KTLEEID ++
Sbjct  527  M-PETKDKTLEEIDDIF  542


> KLWIg2895 KLWIg2895 undefined product 5880109:5881806 forward 
MW:63109
Length=566

 Score =  157 bits (397),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 241/506 (48%), Gaps = 60/506 (11%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDS  67
            LR ++   T ++   H+  + ++GF A  +G++ G D + +S + IG     +  S  DS
Sbjct  75   LRRMEIYPTTFQNKKHM--VIMLGFFASFAGILSGVDQSIISGASIGMRKALNLTSEEDS  132

Query  68   LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVG  127
            L    +++ M  G+  GS++    S+ FGRKV+L I    + IG IL  AAQD   +  G
Sbjct  133  L----VSSLMPLGAVGGSMLLTPLSEYFGRKVALVISCVFYTIGGILCAAAQDVHTMYAG  188

Query  128  RVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA  187
            R + G+G+G       VY +E  P  +RG++  L+QF++ +G +  + I  G  F D   
Sbjct  189  RFLLGLGVGIEGGGVGVYIAESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVKG  246

Query  188  AFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE-----  242
             +R   G  ++   IL +G+FF+PESPRWL +     E   +   +    D+ N+     
Sbjct  247  GWRFMVGSSLLFSTILFIGLFFLPESPRWLVHKGYKTEAYQVWTRLRDVSDIRNKWEFLE  306

Query  243  --QVRFQLEEIKEQVIIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVM  296
                  Q EE+++Q   +S  KN    DLF     ++ L  +++ VS     QL G+N +
Sbjct  307  MTHAAEQDEELRKQ---ESKMKNM--FDLFLIPRNRRALIYSVMMVS---LGQLTGINAI  358

Query  297  MYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFT  354
            MYY+  +    G++   ++  S +     ++ TIPA+  +DKFGRRP  + IIG      
Sbjct  359  MYYMSTLMGRIGFSQKRSVAMSMVGGAALLLGTIPAILYMDKFGRRPWSMTIIG------  412

Query  355  WLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE-NTSAANGVIASSYLFVCFFAPTWGIG  413
              FSV  +L                V  QI  E N +AA GV  +  +    F  T+   
Sbjct  413  --FSVGLVLV--------------GVGYQINMETNMAAAEGVYLTGQILYNIFFGTYATL  456

Query  414  IWIYCSEIFNNMERAKGSALSAA--TNWAFNFAL---AMFVPSAFKNISWKTYIIFGVFS  468
             W+  SE F+   R+ G  + ++    WAF        M V   +  ++   Y    +  
Sbjct  457  TWVVPSESFSLATRSIGMTVCSSFLYLWAFTVTYNFNRMKVAFTYTGLTLGFYGGLAIL-  515

Query  469  VALTIQTFFMFPETKGKTLEEIDQMW  494
            + +  Q  FM PETK KTLEEID ++
Sbjct  516  IGIPYQLLFM-PETKDKTLEEIDDIF  540


> KLWIg4564 KLWIg4564 undefined product 9312936:9314630 reverse 
MW:62529
Length=565

 Score =  157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 137/495 (28%), Positives = 219/495 (45%), Gaps = 58/495 (11%)

Query  33   FIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLT---------YGGITASMAGGSFL  83
            F   +SG  FG+D  ++  +     +  YF   +  T          G I AS   G   
Sbjct  87   FGVSLSGSFFGYDTGTIGGITTMKPWLQYFGKLEEKTNEYHLPEVVIGSIVASFHVGCVT  146

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIG--AILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
            G       +D  GRK+ + I   ++++G   IL          ++GR+I G+ +G     
Sbjct  147  GGFTIGRLTDRLGRKIPIAIACIVYMVGLIVILTSPRGHWYQFLIGRIILGLTVGANGVL  206

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVP  199
             P+Y SEI+PP+IRG    L+  ++T  I++ +   Y    H+ D       TW   ++ 
Sbjct  207  VPMYLSEIAPPRIRGITVNLYSINITHAILIGYIADYASKSHYTDNR-----TWKYPLIG  261

Query  200  GLILMVGVF----FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKE--  253
            G I+ V +     F PESPR L     +++    +A +    + N E +   L+ I E  
Sbjct  262  GFIIGVVILAVLPFAPESPRSLIKMGHFDKAKKCIAKMKHIKNYNPEALPSDLDYISEVD  321

Query  254  -------QV--IIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIF  304
                   QV  I ++ A++  +  LF K+ L +T+ G       QL G++  +YY   +F
Sbjct  322  KEFLFLKQVYYIQETEAQSTTFWMLFSKRFLRRTVSGALIMGLNQLSGVDYFLYYGTKLF  381

Query  305  NMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGI  362
            N  G   +   + S I   +N   T  A+F+ D FGRR  L+ G I  F  L  FS  G+
Sbjct  382  NSVGL--HDPYITSIIMGSINAGGTWAAIFVADNFGRRRGLLWGSIGCFVCLTVFSTIGV  439

Query  363  LATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIF  422
                        +GD        S+   A   ++ S+ +F+  F  +W +   +  SEIF
Sbjct  440  TLI--------DHGDG-------SKTKLAGIIMVVSTCIFLIIFCCSWAVIAPVLLSEIF  484

Query  423  NNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFG---VFSVALTIQTFFMF  479
                ++KG A S + NW  NF +A+  P     I +    +F    +FSV   + T    
Sbjct  485  TLQIKSKGMAFSQSFNWGANFFIALCTPFITAKIGYGFGFVFAGSTLFSVFFVLATI---  541

Query  480  PETKGKTLEEIDQMW  494
            PETKG +LEEID+ +
Sbjct  542  PETKGMSLEEIDEYY  556


> KLWIg2612 KLWIg2612 undefined product 5339084:5340703 reverse 
MW:60070
Length=540

 Score =  156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 140/522 (27%), Positives = 230/522 (45%), Gaps = 75/522 (14%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSS-MIGTDVYKDYFSNPDSLTYGGITASMA  78
            + +P      V+   + I GL+FG+D   +S  +I  +      S  ++     IT+   
Sbjct  41   RPYPFTLKTCVMFLSSTIGGLLFGYDTGVISGVLIAMNPSDIRLSRLENWQREVITSITC  100

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+++   +D+ GRK +L +C  ++ + +++  ++    MLI GR + G+ +G  
Sbjct  101  AGSFVGSILAFPLADSCGRKNTLTVCCVIFAMASMIMASSFTLGMLISGRFVVGIAVGIA  160

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID-----GAAAFRITW  193
            +   P+Y SEISP KIRGT+  L   S+T G    + I Y    ID     G +A+R  +
Sbjct  161  AQCIPIYLSEISPAKIRGTMLTLNSISITGGQFFAYLIAY--WMIDAKNPTGNSAWRYLF  218

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNN------------  241
             L  +P ++ ++ +  IPESPRWL +  R  E    +  I +    N             
Sbjct  219  ALGALPAIVFLLTLDCIPESPRWLLSKARLIEAESALQTIYSTATANEIHLKMKKMANDL  278

Query  242  EQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTL--PKT--IVGVSAQMW----------  287
             +VR+  +E +  ++     ++       R   +  P T   VG     W          
Sbjct  279  NKVRYYSDETEPLILPGRKRRSVASSRTARSSVIGVPYTNQQVGKKIHRWESKSKRALLI  338

Query  288  -------QQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFG  340
                   QQL G N  MYY   IF   G+     LV + +    N   TI A+ LID  G
Sbjct  339  ASVLMFFQQLSGFNAFMYYSATIFEQVGF--ENPLVPAIVVAFTNFCFTIFAIRLIDTIG  396

Query  341  RRPVLIIGGIFMFT---WLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIA  397
            RR ++++  I++ T    L SV   L TYS+                          +I 
Sbjct  397  RR-MMLLSTIWIMTIGLLLCSVGFELKTYSL--------------------------LIV  429

Query  398  SSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-  456
            S  ++V  +A   GI  W    E      RA G ++ + TNW  N  +++   +    I 
Sbjct  430  SVIVYVAAYATGMGIVPW-SSVEFLPLNRRAIGGSVISCTNWFTNSVVSLTYLTVMDKIG  488

Query  457  SWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
            S  T +IF +F+V   +  F  +PE KG +LEE+ Q++ + +
Sbjct  489  SENTMLIFALFTVFNWLFVFIWYPEVKGLSLEEVGQVFENGV  530


> KLDOg2506
Length=540

 Score =  149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 134/518 (26%), Positives = 232/518 (45%), Gaps = 68/518 (13%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY-FSNPDSLTYGGITASMA  78
            + +P  + I V+   + I GL+FG+D   +S  +     KD      D+     IT+   
Sbjct  42   RPYPVTWRISVMFLSSTIGGLLFGYDTGVISGALIAINPKDLGLHVLDNWQKELITSITC  101

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+++   +D  GRK +L +C  ++   ++L   +    ML+ GR++ G+ +G  
Sbjct  102  AGSFIGSILAFPLADKCGRKNTLTVCCVIFAASSMLMAVSFTFHMLVTGRLVVGIAVGIA  161

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA-----AAFRITW  193
            +   P+Y +EISP KIRGT+  L   S+T G  + + I +    ID       +A+R   
Sbjct  162  AQCIPIYLTEISPAKIRGTVLALNSISITGGQFIAYVIAF--FLIDSEHPHSNSAWRYLL  219

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVAN---GDVNNE--------  242
             L  VP +  ++ + FIPESPRWL +  R  E    +  +      G++  +        
Sbjct  220  ALGCVPAIFFLLTLDFIPESPRWLLSKSRLVEAETALQTVYPKATIGEIRQKLKKLTSDL  279

Query  243  -QVRFQLEEIKEQVI-----IDSAAKNFGYKDL---------------FRKKTLPKTIVG  281
             ++R+  +E +  ++        A+   G   L               +  K+     +G
Sbjct  280  NKLRYHNDETEPLLLPVNKRRSVASSRTGRSSLGATYFNDQLGKKRHRWEAKSKRALAIG  339

Query  282  VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGR  341
                 +QQ+ G N  MYY   IF+ AG+T    LV + I    N   T+ +L LID  G+
Sbjct  340  CILMFFQQITGFNAFMYYSTTIFDRAGFTN--PLVPAIIVAFTNFSFTLLSLKLIDTVGK  397

Query  342  RPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYL  401
            R +L++       W+ + AG+L                 ++     N S    +I S  +
Sbjct  398  RILLLLT-----IWIMT-AGLLL---------------CSVGFELNNLSL---LIISVIV  433

Query  402  FVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-SWKT  460
            +V  +A   G+  W    E      RA G ++ + TNW  N  L+M   +    I +  T
Sbjct  434  YVGAYAVGMGVVPW-SSVEFLPLNRRAVGGSIISCTNWFTNALLSMSYLTVMDAIGNENT  492

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
             +IF  F++   +  +  +PE KG +LEEI +++ + +
Sbjct  493  MLIFAFFTILNWLFVYIWYPEVKGLSLEEISRVFENGV  530


> KLDOg2855
Length=568

 Score =  149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 142/496 (29%), Positives = 237/496 (48%), Gaps = 52/496 (10%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASM  77
            +K   H+  + ++GF A  +G++ G D +++S +  G        S+ DSL    +++ M
Sbjct  87   FKNKTHM--VIMLGFFASFAGILSGVDQSTISGASHGMRSTLGLSSDQDSL----VSSLM  140

Query  78   AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGF  137
              G+  GS++    S+  GRKV+L +    + IG IL  AA D   +  GR + G+G+G 
Sbjct  141  PLGAVAGSILLTPLSEYLGRKVALVVSCIFYTIGGILCAAAHDVHTMYAGRFLIGVGVGI  200

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
                  VY +E  P  +RG++  L+QF++ +G +  + I  G  F D    +R   G  +
Sbjct  201  EGGGVGVYIAESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVHGGWRFMLGSSL  258

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ--V  255
            V   +L  G+FF+PESPRWL +     E   +   +    D+ +++   +++   EQ   
Sbjct  259  VFSTVLFFGLFFLPESPRWLIHKGFDVEAYQVWRRLRDTSDIASKREFLEMKHAAEQDKQ  318

Query  256  IIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
            + D  +      DLF     ++ L   I+ VS   + QL G+N +MYY+  +    G++ 
Sbjct  319  LRDQESTFKSMFDLFLIPRNRRALIYAIMMVS---FGQLTGINAIMYYMSTLMGEIGFSP  375

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFTWLFSVAGILATYSVP  369
               +  S +     ++ TIPA+  +DKFGRRP  + IIG        FSV  +L      
Sbjct  376  KRAVAMSMVGGAALLLGTIPAILYMDKFGRRPWSMTIIG--------FSVGLVLV-----  422

Query  370  APGGVNGDDTVTIQIPSE-NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
                      V  QI  E N +AA GV  +  +    F  T+    W+  SE F+   R+
Sbjct  423  ---------GVGYQINLETNLAAAEGVYLTGQILYNIFFGTYATLTWVIPSESFSLATRS  473

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFS-----VALTIQTFFMFPETK  483
             G  + +A  + + F +  +  +  K+    T +  G +      +A+  Q  FM PETK
Sbjct  474  IGMTICSAFLYLWAFTVT-YNFNRMKDAFTYTGLTLGFYGGIAIVIAIPYQLLFM-PETK  531

Query  484  GKTLEEIDQMWVDNIP  499
             KTLEEID+++  N+P
Sbjct  532  DKTLEEIDEIF--NMP  545


> KLWIg4394 KLWIg4394 undefined product 8954749:8956047 forward 
MW:47810
Length=433

 Score =  147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 114/432 (27%), Positives = 193/432 (45%), Gaps = 61/432 (14%)

Query  34   IACISGL-MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFL  83
            I  ++G  +FG+D   MS +I    +   F      S+ D   ++  G +T+    G F 
Sbjct  27   ITAVTGFSLFGYDQGLMSGIITGSQFNQEFPATKEKSSNDRHATVVQGAVTSCYELGCFF  86

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            GSL      +  GR +                         ++GRVI+G+G G  +S  P
Sbjct  87   GSLFVMIRGERTGRGL----------------------GQFVIGRVITGLGTGMNTSTIP  124

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            V+ SE+S P+ RG +  L    + +G M+ ++I +G  ++D +  +R    +Q+   ++L
Sbjct  125  VWQSEMSKPENRGLLVNLEGSVIALGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFAILL  184

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN  263
            ++G+  +P+SPRWL    R EE   I+  +  + D N++Q+  ++  I++ V      K 
Sbjct  185  LIGIVQLPDSPRWLIAQGRREEAMYILGKL-DDLDPNDDQIIAEVSGIQDAVNRFKNQKT  243

Query  264  FGYKDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNLVASS  319
               K+L    + + L + +V  S Q +QQ  G N  +YY   +F+          L+   
Sbjct  244  -SLKELLTGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFHKTIKLDYRLALILGG  302

Query  320  IQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDT  379
            +   +  + TIP+ FLI+  GRR + ++G +                      G     T
Sbjct  303  VFSTVYAISTIPSFFLIETLGRRKLFLLGAL----------------------GQGISFT  340

Query  380  VTIQIPSENTSA-ANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATN  438
            +T     ++T   A G     +LF+ FF        WIY  EI +   R+  +ALS  TN
Sbjct  341  ITFACLIDDTKQNAKGAAVGLFLFIVFFGMALLSLPWIYPPEIASMRVRSATNALSTCTN  400

Query  439  WAFNFALAMFVP  450
            W  NFA+ MF P
Sbjct  401  WLCNFAVVMFTP  412


> KLAEg3319 KLAEg3319 undefined product 6983352:6984896 reverse 
MW:58701
Length=515

 Score =  145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 122/478 (26%), Positives = 215/478 (45%), Gaps = 21/478 (4%)

Query  24   HVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFL  83
            HV  + ++ +   +SG+  GFD   MS    +  +     NP     G +TA    G  +
Sbjct  48   HVMRLNMLIYPIVLSGIFNGFDAFLMSVAQMSPHWFSVMGNPSGAVLGALTAGPQFGYCM  107

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
               ++   SD +GR+ +  I A +   GA++Q  +   A   V RVI G G+ F   AAP
Sbjct  108  ALWLARYVSDKYGRRAASIIGALITTAGALIQSFSNCYAAFFVSRVILGWGLSFYFVAAP  167

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
             + SE++ P  R     +F  S  +G M+  ++ YG + ID    +RI    Q++  L  
Sbjct  168  AWISELALPSHRSVFVAIFNGSAFLGAMMATWVAYGSYVIDSNWQWRIPTLSQLIVSLFH  227

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            +V  +F+PESPR+L + DR +E   ++      N +  NE V ++  +I   +  +  A 
Sbjct  228  LVVFWFVPESPRFLVSKDRTKEAKEVLTKYHGGNMEEFNEFVEYEYNQIVIVLNQEKVAT  287

Query  263  NFGYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN-TNLVASSI  320
               +   F+ +K   +  +       Q   G+  + YY+  +  + GY+ N   L+ +S+
Sbjct  288  KASWMTFFQSRKNFHRFAICAFMGFMQYNVGLFAITYYMSPVLIVTGYSSNRQQLLIASV  347

Query  321  QYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV-PAPGGVNGDDT  379
                N+ +     FL+ +F RRPV           LF++  + ATY V     GVN +  
Sbjct  348  LATFNLAIAYGPPFLVTRFRRRPVF----------LFNLVMLFATYLVFVVLSGVNIE--  395

Query  380  VTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW  439
                      S +  ++A  ++   F+  ++   + +Y  +I     R++G  +   +  
Sbjct  396  -----AGYKMSYSRCILAMIFIVYFFYVISFLGMLTVYIMDILPFSLRSRGIMVYIISGQ  450

Query  440  AFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
             +    +   P A  +ISWK YI++           +F+FPETKG +LEE +  + D 
Sbjct  451  LWVIFNSFITPVAMDSISWKFYIVYCCTIAFCFAFVYFLFPETKGYSLEETETFFGDK  508


> KLWIg2785 KLWIg2785 undefined product 5684463:5686046 reverse 
MW:58332
Length=528

 Score =  145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 129/485 (27%), Positives = 235/485 (49%), Gaps = 52/485 (10%)

Query  38   SGLMFGFDIASMSSMIGTDVYKDYFSNP-DSLT---------YGGITASMAGGSFLGSLI  87
            SG +FG+D+ ++  +     +++YF    D  T          G I +       LG L 
Sbjct  65   SGFIFGWDVGTIGGITNMRAFQEYFGTKWDPFTESHYIPKILVGVIVSIFNISCALGGLF  124

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQ--CAAQDQAMLIVGRVISGMGIGFGSSAAPVY  145
                +D  GRK  ++    ++ +G ++   C  Q   M    R I+G+G+G  +   P++
Sbjct  125  LVKIADIQGRKQGIYASITIYSLGTLVSWTCGPQWWYMF-CARFIAGLGVGATAVMVPMF  183

Query  146  CSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCH---FIDGAAAFRITWGLQMVPGLI  202
             SE +P KIRG +   +Q  +T+GI++   I Y C     ++  + ++I  GL  +  +I
Sbjct  184  ISESAPVKIRGAMVVFYQLMITLGILMGNIINYSCKRTLHVNDNSTWKIPLGLGNIWAVI  243

Query  203  LMVGVFFIPESPRWLANH----DRWEETSLIVANI-VANGDVNNEQVRFQL--EEIKEQV  255
            +++GV F+PESP +L N        +++   + N+ + +  VN   ++  L  E  KE  
Sbjct  244  VVIGVHFMPESPVFLINQMGNAAMAKQSFAKMNNLNIEDPKVNEHILKLVLNHENAKE--  301

Query  256  IIDSAAKNFGYKDLFRKKTLP-KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN--  312
             I ++++N   + +F +  L  +  +G+    +QQL G N   YY   +FN  G   +  
Sbjct  302  -ISNSSRNTKLEFVFGEPKLGLRLFIGIMVMAFQQLSGANYFFYYGTALFNSIGIEDSYI  360

Query  313  TNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPG  372
            T+++ SS+    N V T   ++L++K GR+  L++G I MF           + S+ A  
Sbjct  361  TSILLSSV----NFVSTFLGVYLVEKLGRKACLVLGSIGMFI----------SMSIYASV  406

Query  373  GVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSA  432
            G       +  + S  T+A   +I  + +++ FFA T G   ++  SE+F    +A   A
Sbjct  407  G-------SFLLQSNATTAGIVMIIFTCVYITFFACTSGPVSFVVISELFPARTKAISMA  459

Query  433  LSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTF-FMFPETKGKTLEEID  491
            +  + NW  NF +++  P   + I +K   +F  F + ++I  F FM  ETK K ++E+D
Sbjct  460  VCTSVNWICNFLISLCTPYVTEIIGFKFGYVFACF-LFISIWFFIFMLKETKNKNIDEVD  518

Query  492  QMWVD  496
             M+ +
Sbjct  519  AMYAN  523


> KLAEg4445 KLAEg4445 undefined product 9466981:9468678 reverse 
MW:63766
Length=566

 Score =  143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 119/495 (25%), Positives = 223/495 (46%), Gaps = 21/495 (4%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSL  68
            + D+  E   + K PH+  +    F   +S  + G+D + ++ +    ++ ++F +P   
Sbjct  74   IEDLIREKRPFYKAPHLLKLVFYVFALTMSATISGYDGSMLNGLQSLTIWNNFFGDPTGS  133

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
              G I      G  +   +SP  SD FGRK+++ + +++ ++GAILQ  + + A  +V R
Sbjct  134  RLGVIANGYNFGGLIAFPVSPFLSDKFGRKIAVVVGSSIIVLGAILQGVSTNFAFFLVAR  193

Query  129  VISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAA  188
            ++ G G G    ++PV  SEI+ P  R   +  +     +G  +  ++ YG   +    +
Sbjct  194  IVIGFGSGISGVSSPVLISEIAYPLHRSASTFSYNVCYYLGATIASWVTYGTRVLPNNHS  253

Query  189  FRITWGLQ-MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVR--  245
            +RI   LQ ++P L + V +F +PESPR+L +  + +E   ++  +  +G  + + V+  
Sbjct  254  WRIPSFLQGLMPLLQIAVVLFLVPESPRFLVSKGKVQEAEDVIFRLHTDGSKHEQDVQLV  313

Query  246  -FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMW--QQLCGMNVMMYYIVY  302
             F+L EI+  + I+   K   Y D  +  T  +    ++  M    Q  G  ++ YY+  
Sbjct  314  EFELNEIQNALEIEKKTK-VSYTDFVKSGTNLRKRFFITFWMAAITQFSGNGLLSYYLSK  372

Query  303  IFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGI  362
            + +  G T     +  +   ++  +          KF +R  L +GG+      + +  +
Sbjct  373  VLDSIGITDEKQQLQINGCLMIYCLAICTVFCYTLKFFKRRTLFVGGMSSMLVCYIIWTV  432

Query  363  LATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIF  422
            L+               +  Q   E+   A GV+A  +LF   F        ++Y +EI 
Sbjct  433  LS--------------ALNQQRNFEDKGLAKGVLAMIFLFTFAFNFALNGIPYLYLTEIM  478

Query  423  NNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPET  482
                RAKG  L        +       P A + I WK YI++    +   +  +F+FPET
Sbjct  479  PYSYRAKGMNLFYGWVMVISIFNGFVNPIAMQAIEWKYYIVYCCVILVEVVVVYFVFPET  538

Query  483  KGKTLEEIDQMWVDN  497
             G TLEE+ Q++ D 
Sbjct  539  SGFTLEEVGQVFGDE  553


> KLAEg2435 KLAEg2435 undefined product 5174375:5175973 reverse 
MW:58858
Length=533

 Score =  142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 133/515 (26%), Positives = 235/515 (46%), Gaps = 51/515 (9%)

Query  10   RDIQYEGTFYKKFPHVYNIYVIGFIACIS----GLMFGFDIASMSSMIGTDVYKDYF-SN  64
            ++   E  F K     +   +I  + C++    G +FG+D+ ++  +     +++YF + 
Sbjct  40   KETPTEEKFLKVESSPFADNLIPILLCLATSFGGFIFGWDVGTIGGVTNMVTFQNYFGTQ  99

Query  65   PDSLT---------YGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ  115
             DS+           G I +       LG L     +D  GRK  ++   A++  G ++ 
Sbjct  100  YDSVNNVFYFPMILVGAIVSIFNVSCALGGLFLAGLADIQGRKFGIYAALAIYSSGTLVS  159

Query  116  CAAQDQA-MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLF  174
                +Q       R I+G+G+G  +   P++ +E +P KIRG++  L+Q  +T+GI+   
Sbjct  160  WTCGNQWWYFFCARFIAGLGVGATAVMVPMFIAESAPLKIRGSMVVLYQLMITLGILTGN  219

Query  175  YIGYGCHF---IDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDR---WEETSL  228
             I Y C     +   A +++  GL  +  +I+ +G  F+PESP +L N  R       S 
Sbjct  220  VINYVCKTTIPLSNNATWKVPLGLGNLWAVIIALGTHFMPESPVFLINKRRNVLEARKSF  279

Query  229  IVANIVANGD---VNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLP-KTIVGVSA  284
               N +   D   + N    F   E K  +   +  KN  ++ LF +  L  +  +G+  
Sbjct  280  ATMNNLPPDDQKVIENINELFNTAETK-ALESQTNGKNNRFEFLFGEPKLGLRLFIGIMV  338

Query  285  QMWQQLCGMNVMMYYIVYIFNMAGYTGN--TNLVASSIQYVLNVVMTIPALFLIDKFGRR  342
              +QQL G N   YY   +F   G   +  T+++ SS+    N + T   ++L++K GR+
Sbjct  339  MAFQQLSGANYFFYYGTSLFGSVGIEDSYITSILLSSV----NFISTFGGVYLVEKLGRK  394

Query  343  PVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLF  402
              LIIG + MFT +          ++ A  G       +  +  +  S    +I  + ++
Sbjct  395  SCLIIGSVGMFTCM----------TIYASVG-------SFLLSDQAESVGIIMIVFTCIY  437

Query  403  VCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYI  462
            + FFA T G   ++  SE+F    +A   A+  + NW  NF +++  P   + I +K   
Sbjct  438  IMFFACTSGPVTFVVISELFPAKTKALSMAICTSINWICNFLISLLTPFITEKIGFKFGF  497

Query  463  IFGVFSVALTIQTF-FMFPETKGKTLEEIDQMWVD  496
            +F  F +  +I  F FM  ETK KT EEID M+ +
Sbjct  498  VFSAF-LFFSIWFFIFMLRETKNKTPEEIDSMYAE  531


> KLDOg3292
Length=526

 Score =  139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 124/479 (26%), Positives = 220/479 (46%), Gaps = 46/479 (9%)

Query  38   SGLMFGFDIASMSSMIGTDVYKDYF-SNPDSLT---------YGGITASMAGGSFLGSLI  87
            +G +FG+D+ ++  +     ++++F +  D+ T          G I +       +G L 
Sbjct  67   AGFIFGWDVGTIGGITSMASFQNFFGTRLDTATNTHYFPKILVGLIVSIFNISCAIGGLF  126

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
                +D  GRK  ++    ++ +G ++              R I+G+G+G  ++  P++ 
Sbjct  127  LVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFIAGLGVGATAAMIPMFI  186

Query  147  SEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA---AAFRITWGLQMVPGLIL  203
            SE +P  IRG +  L+Q  +T+GI++   + YGC         A ++I  GL  +   I+
Sbjct  187  SESAPINIRGAMVVLYQLMITLGILIGNVVNYGCKSTLNEFDNATWKIPVGLGNIWAAIV  246

Query  204  MVGVFFIPESPRWLA----NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             VGV F+PESP +L     N  R +E+   + N+  +  + +  +R  +E    +   + 
Sbjct  247  AVGVHFMPESPVFLTQRMGNILRAKESFARMNNLGIDDPIVDSHIRKLMEYDDTRKSTNG  306

Query  260  AAKNFGYKDLFRKKTLP-KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
                F +  +F +  L  +  VGV    +QQL G N   YY   +FN  G       V S
Sbjct  307  RESRFEF--IFGQPRLGFRLFVGVLVMAFQQLSGANYFFYYGTTLFNSVGM--EDPYVTS  362

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVPAPGGVNG  376
             +   +N + T   ++L++K GRR  LI+G I MFT +  ++  G      VP  GG   
Sbjct  363  ILLSTVNFISTFFGIYLVEKLGRRACLILGSIGMFTCMTVYASVGSFLLDKVPQTGGAI-  421

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
                              +IA + +++ FFA T G   ++  SE+F    +A   A+  +
Sbjct  422  ------------------MIAFTCVYIMFFACTSGPVSFVVISELFPTRTKAISMAICTS  463

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
             NW  NF +++  P   + I +K   +F G   ++  + T F+  ETK KT EE+D ++
Sbjct  464  VNWICNFFISLCTPFVTEKIGFKFGFVFSGCLFISFWVFT-FLLKETKNKTSEEVDILY  521


> KLAEg3794 KLAEg3794 undefined product 8015797:8017485 forward 
MW:62145
Length=563

 Score =  135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 135/497 (28%), Positives = 220/497 (45%), Gaps = 40/497 (8%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDS  67
            L  I+  G + +++   + +Y + FI      M G+D + M S+   + Y  Y++ + +S
Sbjct  43   LEGIELPGAWSRQY---WKLYGMCFIVYFCSTMQGYDGSLMGSIYTMEAYLKYYNLDVNS  99

Query  68   LTYGGITASMAG-----GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQA  122
             T  G+  S+       G+F  SL+     D  GRK ++ +     ++ AI+  A   + 
Sbjct  100  STGTGLVFSIYNIGQICGAFFVSLM-----DWKGRKPAILVGCFGVVVAAIITAATSTKG  154

Query  123  MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--  180
             LI GR +         SAAP YC E++P  +RG ++GL+      G +V  +  YG   
Sbjct  155  ALIGGRWLLAFAATIACSAAPSYCVEVAPAHMRGKVAGLYNTLWYAGSLVAAFSAYGAEL  214

Query  181  HFIDGAAAFRITWGLQ-MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDV  239
            H      +F++   LQ M P L+ + G + +PESPRWL    R EE    +A    NGD 
Sbjct  215  HHPGDPMSFKLPLWLQLMFPSLVCIFG-WILPESPRWLVGVGREEEARKFIAKYHCNGDE  273

Query  240  NNEQVRFQLEEIKEQ---VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMW-QQLCGMNV  295
            ++  +  ++ E+ E    V +    +    + L R ++       V A  W  Q  G NV
Sbjct  274  SHPLIDVEIAEMIESFQGVKLADPIRVLDLRPLVRTRSNRYRTGLVVAMAWFGQFSGNNV  333

Query  296  MMYYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFT  354
              YY+  +    G T  +TN++ + I  +++   +I   F  DK GRR       +FM +
Sbjct  334  CSYYLPTMLTNVGMTSTSTNVLMNGIYSIVSWAASICGSFAHDKVGRRK------MFMGS  387

Query  355  WLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI  414
             L S   +       A     G D            A+ G +   YLF   F+  +    
Sbjct  388  TLGSALALTGLAISTARFKATGSD-----------GASTGTLVFIYLFGVVFSFAFTPMQ  436

Query  415  WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ  474
             IY SE+ +N+ R+K   +   T     F      P A +NIS+  Y+ +  F +     
Sbjct  437  PIYPSEVSSNLLRSKSQLVLNVTAGVAQFVNQFAAPKAMQNISYWFYVFYVFFDIFEFFI  496

Query  475  TFFMFPETKGKTLEEID  491
             +F F ETKG +LEE+D
Sbjct  497  VYFFFVETKGLSLEELD  513


> KLWIg4787 KLWIg4787 undefined product 9768780:9770465 forward 
MW:63955
Length=562

 Score =  135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 134/541 (25%), Positives = 233/541 (44%), Gaps = 48/541 (8%)

Query  16   GTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITA  75
            G  + K PH+  + +  FI  ++    G+D + ++ +     + +   NP   T G I+ 
Sbjct  49   GRPFWKVPHLLKLSLHIFILSLASTNNGYDGSLLNGLYAMPDFMNAIGNPSGATLGVISN  108

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHI-------------CAALWIIGAILQCAAQDQ-  121
             M  G      ++P   D +GRK  ++I             C+  WI G       +D  
Sbjct  109  GMPFGLVFAFFLAPYVIDKYGRKSGIYIGNVLICIGVLIQSCSGAWIHGLPKNNTKRDIF  168

Query  122  AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCH  181
             M  V RVI G+G    + A P   SEIS P  R   + L+     +G +V  ++ YG  
Sbjct  169  GMFFVSRVILGIGTYSVNIATPALISEISYPAHREICTSLYNTCWYLGALVAAWVSYGTR  228

Query  182  FIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN-  240
             +     +RI   +Q +  ++ +  V+  PESPR+L  H+R ++   I+    A  D   
Sbjct  229  NLAHHWNWRIPSIIQALFPIVQLFLVYLCPESPRFLIYHNRDDDARRILMKFHAGNDERF  288

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI-VGVSAQMWQQLCGMNVMMYY  299
            +  + F++ EIK  +  +  AK+  Y + +R     + + + V   ++ Q  G  ++ YY
Sbjct  289  STLIDFEMSEIKLAIEQEKLAKDTSYLEFYRTSGNRRRLWIVVWVGIFMQFSGNGLVSYY  348

Query  300  IVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDK--FGRRPVLIIGGIFMFTWLF  357
            +  +F+  G T     +  +   +L   +T   L       F RR + +I  + M     
Sbjct  349  LSKVFDSIGITDPDEKLEWNGWLMLYNWLTASLLMFCAAPFFKRRQMFLISLVSM-----  403

Query  358  SVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG--IW  415
             +  I+ T    A    N           E+ + A GV+A  +L+  +F+  +G+    +
Sbjct  404  CICYIIWT----ALSAENQKRNF------EDKAFAKGVLAMIFLY--YFSYNFGMNGFPF  451

Query  416  IYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQT  475
            +Y +EI     R KG  +   +            P A   I WK YI+F  F     +  
Sbjct  452  VYVTEILPYTLRGKGLTIFQVSQTCVTIFNGFVNPVAMDAIEWKYYIVFCCFLGLEILIC  511

Query  476  FFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQL-PIVKDEEGNKLGLLGNPQHLEDVH  534
            +F F ET G+TLEE+D+++ D I       ++P +   V  E+G K+ +    +HLED  
Sbjct  512  YFTFVETSGRTLEEVDEIFGDGI------KHLPDVTSQVLLEDGRKISV----EHLEDGR  561

Query  535  S  535
            S
Sbjct  562  S  562


> KLAEg349 KLAEg349 undefined product 761997:763964 forward MW:74182
Length=656

 Score =  130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 127/434 (30%), Positives = 198/434 (46%), Gaps = 50/434 (11%)

Query  92   SDAFGRKVSLHICAALWIIGAILQ----CAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            ++ FGRK  + I  A+  I   LQ            L   R + G GIG  S+   VY +
Sbjct  201  NNMFGRKKVIFITCAISAITCFLQGFGPAGVPGWHYLFAFRFLLGFGIGPKSATVSVYLA  260

Query  148  EISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            E +P K+RG +   +Q     GIM      L +   G   I G   +R+  G  M+P ++
Sbjct  261  ECAPKKLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGDSGIAGGLNWRLMLGSAMIPAIL  320

Query  203  LMVGVFFIPESPRWLANHDRW----EETSLIVAN-IVANGDVNNEQVRFQLEEIKEQVII  257
            ++  + F PESPRWL    R+    E T LI  + I+A  D+  + V   +EE   Q+  
Sbjct  321  VLFQIPFCPESPRWLMGKGRYIEAFESTILIRTHRILACRDIFYQHV-LLMEENSLQMSY  379

Query  258  DSAAKNFGYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
             +       K++F  ++     +        QQ C +NV+ YY   IF  +G++  + L 
Sbjct  380  WTR-----LKEVFTVRRNRNAFVTAFICAFMQQFCAINVIAYYSSAIFVESGFSEISALC  434

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
            AS    ++N    IPA F+ID+FGRR +L+      F WL +V  ++A +S         
Sbjct  435  ASLGFGLINFFFAIPAFFMIDRFGRRFLLLN----TFPWL-AVFLLIAGFSFWI------  483

Query  377  DDTVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                      E+T    GV+    Y+F   ++   G+  ++   E+F    RA G++L  
Sbjct  484  ----------EDTQKRIGVVTMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLFT  533

Query  436  ATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ---TFFMFPETKGKTLEEIDQ  492
               W FNF L++  PS  +++  K    FG ++    I     +F  PETK  TLEE+D+
Sbjct  534  IVLWGFNFILSVTWPSMLRSL--KPQGAFGFYAAWNVIGWGLVYFFMPETKQLTLEELDE  591

Query  493  MWVDNIPAWRTANY  506
              V +IP    A Y
Sbjct  592  --VFDIPLMTRARY  603


> KLDOg983
Length=518

 Score =  127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 129/494 (27%), Positives = 220/494 (45%), Gaps = 54/494 (10%)

Query  43   GFDIASMSSMIGTDVYKDYFSNPDSLTYGGITA---------------SMAGGSFLGSLI  87
            GFD    +++   D + + F   D+LT  G+ +                 A G   GSLI
Sbjct  57   GFDNQGFATIQAMDSFIEKFGEYDALT--GLYSIPPKFLSYLNSFQYLGFAFGLICGSLI  114

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            S      FGRK+ +   +   +I A +   +  +  ++  RV + + IG   +  PV+ +
Sbjct  115  S----SRFGRKICVLSMSLYALIPATIGLTSGSKEQILCARVFNYIFIGMEMAVIPVFQA  170

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EI PP  RG   G FQ S+ +G +V+  I      I+  +A+RI  GL  +   I+   V
Sbjct  171  EIVPPNTRGFFVGAFQLSLNIGGLVIHIITNSTAHIENTSAWRIPLGLYYIFPSIIASLV  230

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
             FIPESPRWL    + EE    +  +   G ++   +  + E I + V  +   K+  Y 
Sbjct  231  MFIPESPRWLILKGKKEEAMKSLVRL-RTGTIHENDISKEYESIVKSVEAEKLQKS-QYS  288

Query  268  DLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
            +LF      +TI+ + A  +QQ+ G      Y   IF  +  T N  L+ S +  V+ +V
Sbjct  289  ELFTGTNKRRTIMVILANTFQQVTGQAFSSQYGT-IFIKSLNTVNPFLM-SIVSSVIGIV  346

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
              I  L   D+FGR+  L++G       L ++ G+             G   VT+     
Sbjct  347  AVIIVLIFTDQFGRKRFLVVGSTIQAIALLTMGGL-------------GTGAVTV-----  388

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
              +   GV+A+  +    +  +W    ++  SEI     R K  A+    N  F F  A 
Sbjct  389  --AKKKGVVATMMIKNFSYCLSWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFLTAF  446

Query  448  FVP----SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRT  503
             +P    + + N+  K   ++G F+V   + ++F+ PE +G +LEEI+  +V+ +P    
Sbjct  447  TLPYLLSAPYANLQSKVGFVYGGFTVLSIVYSYFL-PECRGLSLEEIEFNFVNGVP----  501

Query  504  ANYIPQLPIVKDEE  517
             N   ++P V+++ 
Sbjct  502  LNRFKKMPAVEEKH  515


> KLDOg1861
Length=559

 Score =  125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 131/546 (24%), Positives = 239/546 (44%), Gaps = 72/546 (13%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMA  78
            + K P++ ++    F+  ++    G+D + ++ +     + +   NP +   G I+  M 
Sbjct  47   FYKVPYLRSLSWYIFVLTLASTNNGYDGSLLNGLYAMPDFLNAMGNPSAAELGLISNGMM  106

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA----------QDQ----AML  124
             G  +    +P   D +GRK  +++   L  +G ++Q  +           D+     M 
Sbjct  107  FGILIFFQFAPYVIDKYGRKAGIYLGNVLICLGVLIQSLSGVWINGLPENYDEKDVFGMF  166

Query  125  IVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID  184
            +  RV+ G G+   S A P   SEIS P  R   + LF     +G +V  +I YGC  + 
Sbjct  167  VASRVVLGTGVLLVSIATPALISEISYPPHREVCTSLFNTCWYLGAVVSAWITYGCRNLA  226

Query  185  GAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ-  243
                +RI   +Q    ++ ++ +   PESPR+L  H+R EE   ++    A    NNE+ 
Sbjct  227  HHWNWRIPSIIQAFFPILQIILLMKCPESPRYLVFHNRDEEARELLNQHHAG---NNEEY  283

Query  244  ---VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMNVMMYY  299
               + F+L EIK  +  +  +K+  + D  + K    +  + +   ++ QL G  ++ YY
Sbjct  284  GGLIDFELAEIKLAIEQEKMSKSTKFSDFVKTKGNRHRLWILIWTAIFTQLSGNGLVSYY  343

Query  300  IVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            +  +F   G T  N  L  +    + N + ++  +  I  + +R  L +  +    + F 
Sbjct  344  LSKVFISIGITDPNEQLEWNGWLMLYNWLCSLILMSYIAPYFKRRQLFLISLVSMGFCFI  403

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG--IWI  416
            V   L+  +               +   E+ S ANGV+A  +L+  +F+  +G     ++
Sbjct  404  VWTALSAENQ--------------KRNFEDKSLANGVLAMIFLY--YFSYNFGFNGFPFV  447

Query  417  YCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYIIFGVFSV  469
            Y +EI     R KG A+       F  A+++ +       P A   I WK YI++  F  
Sbjct  448  YTTEILPYTLRGKGLAI-------FQGAISICIIFNGFVNPIAMDAIEWKYYIVYCCFMF  500

Query  470  ALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKD----EEGNKLGLLG  525
                  +F F ET G+TLEE+D+++ D          I QLP +      E+G ++ +  
Sbjct  501  VEVAICYFTFVETSGRTLEEVDEIFGDG---------IQQLPDITSQIILEDGKRISV--  549

Query  526  NPQHLE  531
              +HLE
Sbjct  550  --EHLE  553


> KLDOg3808
Length=547

 Score =  124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 93/324 (29%), Positives = 162/324 (50%), Gaps = 36/324 (11%)

Query  186  AAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVR  245
            A++++I  GLQ V   +L +G+ F+PESPR+    D+ ++ +  ++  +     ++  + 
Sbjct  3    ASSYQIPIGLQYVWSFLLGLGILFLPESPRYYVFRDQLDKAAKSLS-FLRGVPEDDSGLL  61

Query  246  FQLEEIKEQVIIDSAAKNFGYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
             +L EIK     + +     Y D F     R K   + I G++ Q +QQ+ G+N + YY 
Sbjct  62   EELVEIKATYDYEMSFGKLSYFDCFKSTRSRTKQRLRMITGIALQAFQQVSGINFIFYYG  121

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            V  FN  G +   + + S I Y +NV   +P LFL++  GRR +L+ GG+ M        
Sbjct  122  VDFFNKTGVS--ESYLVSLITYAVNVAFNVPGLFLVEYIGRRKLLLGGGVLM--------  171

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
             +++ + V   G           + +E+  A   +IA   LF+  F+ TWG G+W+  +E
Sbjct  172  -VISNFIVAIAG-----------LATESMVANKVMIAFICLFIASFSATWGGGVWVISAE  219

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFK--------NISWKTYIIFGVFSVALT  472
            ++    RAK +A+ AA+NW  NF  A+  P   +         I  K + ++G  +    
Sbjct  220  LYPLGVRAKCTAICAASNWLINFICALLTPYIMRIDTGARETTIGTKIFFLWGSLNAVAV  279

Query  473  IQTFFMFPETKGKTLEEIDQMWVD  496
            +  +F   ET G +LEEIDQ++ +
Sbjct  280  VVVYFTVYETSGLSLEEIDQLYKN  303


> KLDOg4833
Length=602

 Score =  123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 129/518 (25%), Positives = 233/518 (45%), Gaps = 48/518 (9%)

Query  23   PHVYN--IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPD---SLTY-----GG  72
            P VYN  +Y+   +  I G   G+D  ++S  +    +++ F   D   S +Y       
Sbjct  55   PEVYNWTLYMSILVFGILGAARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN  114

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG  132
            IT+ +  GS  G+LI+    + FGR  +L     LWI GAI+Q  +++   L  GR+I G
Sbjct  115  ITSMVQLGSIGGTLIAMYTVEKFGRIKALQGVCVLWIAGAIIQITSKNVGQLYAGRLIEG  174

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            + IG  ++  PVY SE+S  +IRG    LF  +V  GIM+ ++  YG   +  +   R+ 
Sbjct  175  LAIGQTTTIGPVYLSEVSVKQIRGLTGCLFAGAVYFGIMLAYFANYGTA-LHVSNTSRLQ  233

Query  193  W----GLQMVPGLILMVGVF-FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            W     +++V   ++ VG F +  ESPRWL    + ++    +A +  N    +  +  +
Sbjct  234  WVVPTSMKIVLAGLIFVGSFIWCIESPRWLMKMGKDDKAIKNLAKL-RNLSETHPFIAGE  292

Query  248  LEEIKEQVIIDSAA-KNFGYKDLFRKKTLPKT------IVGVSAQMWQQLCGMNVMMYYI  300
            + +I+ Q+I +       GY D+ ++    K+      ++    Q+  Q  G N +  Y 
Sbjct  293  VADIRHQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIACLVQILGQWSGANAITIYA  352

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMT-IPALFLIDKFGRRPVLIIG-GIFMFTWLFS  358
              + ++ G  G   L  +++  V+  V   I A F ID  GR+    IG  I + T L+ 
Sbjct  353  PELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLGRKKAAYIGISIQLLTLLY-  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI----  414
                 A +    P     D  +T         A+   IA+ YL        W +G     
Sbjct  412  ----FALFLTIVPQATESDAILT----KSQFHASQAAIAALYL----SGTGWTMGFNSIQ  459

Query  415  WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS--WKTYIIFGVFSVALT  472
            ++  +E+F    R+   +     +++  F  +  VP    +++     Y   GV  ++L 
Sbjct  460  YLLSAEVFPIRIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGVLFISLL  519

Query  473  IQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQL  510
               FF+ PE  G++LE +++++  ++P +      P++
Sbjct  520  WVHFFV-PEVTGRSLESMEELF--SLPWYMIGTRGPEM  554


> KLDOg2659
Length=667

 Score =  121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 109/419 (27%), Positives = 186/419 (45%), Gaps = 42/419 (10%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
             ++ FGRK  + I   +  +   LQ            L   R + G GIG  S+   +Y 
Sbjct  212  LNNKFGRKKVIFITCLISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATTSIYL  271

Query  147  SEISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            +E S   +RG +   +Q     GIM      L +   G   I G   +R+     M+P +
Sbjct  272  AECSTKHLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGGSGIAGGLNWRLMLASAMIPAI  331

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
            +++  + F PESPRWL    R++E       I  +  +    + +Q   + E+   +S  
Sbjct  332  LVLFQIPFCPESPRWLMGKGRYKEAYESTVQIRNHNILACRDLFYQHVLLMEE---NSLQ  388

Query  262  KNF--GYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
             N+    K++F  ++     +        QQ C +NV++YY   IF  +G++  ++L AS
Sbjct  389  MNYWSRLKEVFTVRRNRNALVTAFICAFMQQFCAINVIVYYSSAIFLTSGFSEISSLCAS  448

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
                ++N    +PA F+ID+FGR+ +L+      F WL ++  I                
Sbjct  449  LGFGLINFFFALPAFFMIDRFGRKFLLLN----TFPWLAALLLITG--------------  490

Query  379  TVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
                    E+T    GV++   YLF   ++   G+  ++   E+F    RA G++L    
Sbjct  491  ---FAFWIEDTEKRIGVVSMGVYLFSAVYSFGCGVVPFVIAGEVFPLYVRAIGASLFTVV  547

Query  438  NWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ---TFFMFPETKGKTLEEIDQM  493
             W FNF L++  PS  +  ++K    FG ++    I     +F+ PETK  TLEE+D++
Sbjct  548  LWGFNFILSLTWPSMLR--AFKAQGAFGFYAAWNVIGWLLVYFLMPETKQLTLEELDEV  604


> KLWIg3342 KLWIg3342 undefined product 6776598:6778562 forward 
MW:74736
Length=655

 Score =  120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 122/435 (29%), Positives = 202/435 (47%), Gaps = 52/435 (11%)

Query  92   SDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            ++ FGR+  + I   +  +   LQ            L   R + G GIG  S+   VY +
Sbjct  201  NNKFGRRKVIFITCVISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATVSVYLA  260

Query  148  EISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            E S  ++RG +   +Q     GIM      L +   G   I G   +R+     M+P ++
Sbjct  261  ECSTKQLRGIVCMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAIL  320

Query  203  LMVGVFFIPESPRWLANHDRWEE---TSLIVAN--IVANGDVNNEQVRFQLEEIKEQVII  257
            ++  + F PESPRWL    R++E   +++ + N  I+A  D+  + V   +EE   Q+  
Sbjct  321  VLFQIPFCPESPRWLMGKGRYKEAYDSTVQIRNHRILACRDLFYQHV-LLMEENSLQMSY  379

Query  258  DSAAKNFGYKDLFRKKTLPKTIVG--VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
             +       K++F  +     +V   + A M QQ C +NV+ YY   IF  +G++  ++L
Sbjct  380  WTR-----LKEVFTVRRNRNALVSAFICAFM-QQFCAINVIAYYSSAIFLQSGFSEISSL  433

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
             AS    ++N    IPA F+ID+FGRR +L+      F WL +V  ++A +S        
Sbjct  434  CASLGFGLINFFFAIPAFFMIDRFGRRFLLLN----TFPWL-AVFLLIAGFSFWI-----  483

Query  376  GDDTVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
                       ++  A  GV++   Y+F   ++   G+  ++   E+F    RA G++L 
Sbjct  484  -----------DDRDARIGVVSMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLF  532

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTF---FMFPETKGKTLEEID  491
                W FNF L++  PS  +  ++K    FG ++    I  F   F  PETK  TLEE+D
Sbjct  533  TVVLWGFNFILSLTWPSMLR--AFKPQGSFGFYAAWNVIGWFLVYFFMPETKQLTLEELD  590

Query  492  QMWVDNIPAWRTANY  506
            +  V ++P    A Y
Sbjct  591  E--VFDVPLMERAAY  603


> KLDOg4814
Length=575

 Score =  118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 120/488 (25%), Positives = 219/488 (45%), Gaps = 48/488 (9%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A ++++    +++  F                  G+   +A G  +G  I+  
Sbjct  79   IMEGYDTAFVNNLFALPIFQTTFGEYSEANGAWEIPSRWQIGLGMCIACGEIIGLQITGT  138

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
             ++ +G +  L     L I    +   A + AM+ VG+++ G+  G   +    Y SE+ 
Sbjct  139  LANRYGYRPVLIGGLFLLIAFNFILYFANNLAMIAVGQILCGIPWGSFQTLCVSYASEVC  198

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVPGLILMVGVF  208
            P  +R  ++    F   +G ++   +  GC  H  +    +++ + LQ +  + L+VG++
Sbjct  199  PLVLRYYLTTYINFCWLIGQLIAAGVLKGCQEHLANEQLGWKLPFALQWIWPVPLIVGIY  258

Query  209  FIPESPRWLANHDRWEETSLIVANI----VANGDVNNEQVRFQLEEIKEQVIIDSAAKNF  264
              PESP WL    R E+    V  I    VA  D+ ++ +  +++   E+ I   A+++ 
Sbjct  259  LAPESPWWLVRKGRMEQAKRSVTRILTLPVAEKDLLSDMMLKKMKMTVEKEI-RLASQST  317

Query  265  GYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
             Y D F+     +T +   + ++Q L G + +M Y  Y +  AG   +     S IQY++
Sbjct  318  SYMDCFKGTDFRRTRISCLSWVFQNLTGAS-LMGYSTYFYEKAGLDTSAAFTFSIIQYII  376

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             +V T  + FL  + GR  +L   GIF     F +  +L T      GG+   D      
Sbjct  377  GIVGTFASWFLSSRAGRYTILF-WGIF-----FQMVVMLIT------GGLGFSD------  418

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
             S+  S   G +   Y F  F+  T G  ++   SEI ++  R + S +  A N A+N  
Sbjct  419  -SKGASWGAGSMLLIYNF--FYNSTSGPVVYCVVSEIPSD--RLRTSTIVLARN-AYNLT  472

Query  445  L---AMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
                ++  P    +  W    KT + +G F+    +  +F  PETKG+T  E+D+++   
Sbjct  473  AIVNSVLTPYMLNSYQWNWGAKTGLFWGGFAALSLVWAYFDLPETKGRTFAELDELFHQK  532

Query  498  IPAWRTAN  505
            IPA + A+
Sbjct  533  IPARKFAS  540


> KLWIg793 KLWIg793 undefined product 1656864:1657811 reverse MW:35581
Length=316

 Score =  117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/316 (28%), Positives = 153/316 (49%), Gaps = 17/316 (5%)

Query  209  FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKD  268
            F+PESPR+L   ++ EE    VA       +++  V+ +++ I      +  A +  + +
Sbjct  3    FVPESPRYLVEKNKLEEAKRSVAR-SNKVSMDDPSVQAEVDLIAAGFEAEQLAGSASWGE  61

Query  269  LF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNV  326
            LF  R K L + I+G+  Q  QQL G N   YY   IFN  G   + +   S +  ++N 
Sbjct  62   LFSTRTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFNSVGL--DDSFETSIVLGIVNF  119

Query  327  VMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPS  386
              T  A++++D++GRR  L+ G           AG+ A   V A  GV            
Sbjct  120  ASTFVAIYVVDRYGRRKCLLWGA----------AGMTACMVVFASVGVTRLWPEGKSAGI  169

Query  387  ENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALA  446
             +  A N +I  +  ++  FA TW    ++  SE +    ++K  AL++A+NW + F + 
Sbjct  170  SSKGAGNCMIVFACFYIFCFATTWAPVAYVVVSESYPLRVKSKCMALASASNWIWGFLIG  229

Query  447  MFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTAN  505
             F P     I+ +  Y+  G          FF+ PETKG +LEE++++W++ +  W++A+
Sbjct  230  FFTPFITTAINFYYGYVFMGCLVFMFFYVFFFV-PETKGLSLEEVNELWLEGVLPWKSAS  288

Query  506  YIPQLPIVKDEEGNKL  521
            ++P     +D + + L
Sbjct  289  WVPSSRRAEDYDADAL  304


> KLAEg2468 KLAEg2468 undefined product 5234109:5235361 reverse 
MW:42450
Length=383

 Score =  112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/305 (27%), Positives = 146/305 (48%), Gaps = 37/305 (12%)

Query  30   VIGFIA-CISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +I F+A  + G++FG+D   +S +++  +      S+ ++     IT+    GSF+GS++
Sbjct  50   IIMFLASTVGGMLFGYDTGIISGALVAMNPEDLRLSHLENWHKEVITSITCAGSFVGSIM  109

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            +   SD +GR+++L +C+ +++  +     +    ML+ GR + G+ IG  +   PVY S
Sbjct  110  ASRISDKYGRRLTLIVCSTIFVFASCFMALSFTLGMLVFGRFLVGISIGVAAQCVPVYLS  169

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGY---GCHFIDGAAAFRITWGLQMVPGLILM  204
            E+SP KIRGT+  L   S+T G  + + I Y       I     +R  +G   +P +  +
Sbjct  170  ELSPAKIRGTVLALNSVSITGGQCLAYAISYLIVDPEKISKNHIWRYLFGFGALPAICFL  229

Query  205  VGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ------------VRFQLEEIK  252
            + + F+PESPRWL +  R+ E    +  I     +   Q            VR+  +E++
Sbjct  230  LALDFVPESPRWLISESRFSEAEQALQVIFPYATLAEIQSKVKKILHDLNKVRYYNDELE  289

Query  253  -------EQVIIDSA------------AKNFGY-KDLFRKKTLPKTIVGVSAQMWQQLCG  292
                   E+  + SA            A +FG  K  +  +++    VG    ++QQ+CG
Sbjct  290  PIIAPRTERFSVTSARTGTISLAVISNAPSFGKIKHRWEARSIRALTVGSILMVFQQICG  349

Query  293  MNVMM  297
             N  +
Sbjct  350  FNAFI  354


> KLWIg4546 KLWIg4546 undefined product 9279057:9280016 forward 
MW:36089
Length=320

 Score =  109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 92/313 (30%), Positives = 147/313 (47%), Gaps = 23/313 (7%)

Query  203  LMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSA  260
            ++ G+ F+PES R+L   D+ ++   SL   N V+    +N  V F+L  I+  V  +  
Sbjct  1    MIFGMLFVPESARYLVEVDKIDQARNSLAKTNKVSP---DNYIVTFELNSIQASVEAEKL  57

Query  261  AKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
            A +  + +L   K     +T++G+  Q  QQL G N   YY   IF   G   + +   S
Sbjct  58   AGSASWTELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQAVGL--DDSFETS  115

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG--  376
             +  V+N + T  AL+ +DKFGRR  L+ G +          G+ A Y V A  GV    
Sbjct  116  IVLGVVNFISTFFALYTVDKFGRRKCLLWGCV----------GMTACYVVYASVGVTRLW  165

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
             +  +  I S+       V A  Y+F   FA TW    ++  SE +    + K   +++A
Sbjct  166  PEGKSAGISSKGAGNCMIVFACFYIFC--FATTWAPIAYVLISESYPLRIKGKAMGVASA  223

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD  496
             NW + F +  F P     I++    +F    V      FF  PETKG TLEE+++M+ +
Sbjct  224  ANWIWGFLIGFFTPFITSAINFYYGYVFMGCMVFAFFYVFFFVPETKGLTLEEVNEMYAE  283

Query  497  NIPAWRTANYIPQ  509
                W+++ +IP 
Sbjct  284  GTLPWKSSAWIPS  296


> KLWIg1738 KLWIg1738 undefined product 3550425:3552140 reverse 
MW:62861
Length=572

 Score =  108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 108/409 (27%), Positives = 183/409 (45%), Gaps = 35/409 (8%)

Query  95   FGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKI  154
            FGR+  + +   +   G+++Q  +   A L+  R+  G+G+G  SS  P+Y +E +P   
Sbjct  170  FGRRFIIFVSCFIGFSGSLIQAFSNGFACLLFARIYLGIGMGLCSSTVPIYTAECAPAVS  229

Query  155  RGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESP  214
            RG +  L+Q  + +G+ +          I G  ++R+  G   V  LI +  ++  PESP
Sbjct  230  RGALLMLWQTFIALGVCLGSVFNRAFVNIPGNLSWRLMIGSSCVAPLITLFVIYVPPESP  289

Query  215  RWL-ANHDRWEETSLIVANIVANGDVNNEQVRFQLEE--IKEQVIIDSAAKNFGYKDLF-  270
            RWL AN D   E +L     + N DV   +  + L E  I E+ +    + +     LF 
Sbjct  290  RWLIANGDI--EQALKSLMRLRNTDVGGARDFYILYESLIYEKELAPKLSWSEEIVALFS  347

Query  271  RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTI  330
            R++      V     + QQ  G+N+++ Y   I   AG    T +  S        + T+
Sbjct  348  RRRNRFALWVSFIGILGQQYGGVNILVSYTATILTSAGIDPVTAIAGSIGIGGGCFLATL  407

Query  331  PALFLIDKFGRRPVLI----IGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPS  386
             +  LID++GRR +L+    + GI +F WL  V  +                       +
Sbjct  408  ISSQLIDRYGRRRMLLLTIPVEGICLF-WLGGVLNV-----------------------T  443

Query  387  ENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALA  446
            +N+S     + + Y+FV F+    G   +   +E  +   R   SA S + NW  +F L 
Sbjct  444  DNSSRLAAGLTAMYVFVLFYGTGIGPISFTLVAETPSITVRMAHSAFSMSINWLLDFCLT  503

Query  447  MFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            M  P   K+++    + F G F+  +     F  PETK  TLEE+D+++
Sbjct  504  MTWPKMSKSMTASGGLYFYGGFNFLIWTLVLFCVPETKKFTLEELDEVF  552


> KLDOg2454
Length=573

 Score =  107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 109/416 (27%), Positives = 190/416 (46%), Gaps = 41/416 (9%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
             +  +GR+  + I   + + G+++Q  +   A+++  R+  G+G+G  SS  P+Y +E +
Sbjct  168  LNKKYGRRFIVLISCFIGVSGSLMQAFSNGLALMLFSRLYLGIGMGLCSSTVPIYTAECA  227

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI  210
            P   RG I  L+Q  + +G+ +          I+G  ++R+  G   V  LI    +F  
Sbjct  228  PAVSRGAILMLWQTFIALGVCLGSVFNRAFVNIEGDLSWRLMIGSSCVAPLITAFAIFVP  287

Query  211  PESPRWLANHDRWEET--SLI-VANIVANGDVN----NEQVRFQLEEIKEQVIIDSAAKN  263
            PESPRWL  +    E+  SLI + N   +G  +     E + ++  E+  ++      K+
Sbjct  288  PESPRWLIGNGFVLESLKSLIRLRNTEVSGARDFYILYESLNYE-HELAAKLTWSEEIKS  346

Query  264  FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV  323
              + ++  +  L  + VG+   + QQ  G+N+++ Y   I   AG    T +  S     
Sbjct  347  L-FTNIRNRFALWVSFVGI---LGQQYGGVNILVSYTATILVNAGIDPVTAIAGSIGIGG  402

Query  324  LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQ  383
               + T  +  LID++GRR +LI+        LF + GIL                    
Sbjct  403  GCFLATFLSSQLIDRYGRRTMLILTLPVEGACLFWLGGIL-------------------N  443

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNW  439
            I    T  A G +A+ Y+FV FF    GIGI    +   +E  +   R   SA + + NW
Sbjct  444  IEDNQTRLATG-LAAMYVFVLFF----GIGIGPISFTLVAETPSITVRMAHSAFAMSLNW  498

Query  440  AFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
              +F L M  P    +++    + F G F+  +    +F  PETK  TLE++D+++
Sbjct  499  LLDFCLTMTWPKMTVSMTTSGGLYFYGAFNFVVWALAYFTVPETKRFTLEQLDEVF  554


> KLDOg1716
Length=593

 Score =  102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 110/448 (25%), Positives = 193/448 (44%), Gaps = 53/448 (11%)

Query  118  AQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIG  177
            A   AM+ VG+++ G+  G   +    Y SE+ P  +R  ++    F   +G ++   + 
Sbjct  176  ANSLAMIAVGQILCGIPWGSFQTLCVTYASEVCPLVLRYYLTTYINFCWLIGQLIAAGVL  235

Query  178  YGC--HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-  234
              C  H  +    +R+ + LQ +  + L+ G++  PESP WL    R EE    V  I+ 
Sbjct  236  KACQEHLANEQLGWRLPFALQWMWPVPLITGIYLAPESPWWLVRKGRMEEARQSVTRILS  295

Query  235  ---ANGDVNNEQVRFQLEEIKEQVIIDS--AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQ  289
               A  D+ ++ +   + ++K  V  +S  A+    Y D F+     +T +     + Q 
Sbjct  296  LPAAEKDILSDMM---ITKMKMTVEKESRMASSESSYMDCFKGIDARRTRIACLTWVAQN  352

Query  290  LCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGG  349
            L G + +M Y  Y +  AG   ++    S IQYV+ +  T  + FL  + GR  +L  G 
Sbjct  353  LTG-STLMGYSTYFYEKAGLNTSSAFTFSVIQYVIGIAGTFMSWFLTTRAGRFRILFWGI  411

Query  350  IFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPT  409
            +     +               GG+   D       S+  S   G +   Y F  F+  T
Sbjct  412  VSQMIIML------------ITGGLGFSD-------SKGASWGAGSMLLIYNF--FYNST  450

Query  410  WGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF---ALAMFVPSAFKNISW----KTYI  462
             G  ++   SEI ++  R + + +  A N A+N    A A+  P    +  W    KT +
Sbjct  451  LGPVVYCVVSEIPSD--RLRTNTIVLARN-AYNLTVIATAVLTPYMLNSDQWNWGAKTGL  507

Query  463  IFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANY----IPQLPIVKDEEG  518
             +G F+    +  +   PETKG+T  E+D+++   IPA + A+       +  ++KD  G
Sbjct  508  FWGGFAALSMVWAYIDLPETKGRTFAELDELFHQKIPARKFASTHVEPFARETMMKDMSG  567

Query  519  NKLGLLGNPQHLEDVHSNEKGLLDRSDS  546
            N+        +LE +      L  +S+S
Sbjct  568  NQ------DFNLEPIEEENFELRKQSES  589


> KLAEg4274 KLAEg4274 undefined product 9099870:9101591 forward 
MW:64932
Length=574

 Score =  100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 114/525 (22%), Positives = 213/525 (41%), Gaps = 71/525 (13%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A ++S+    ++   F   +  T           G++  +  G  +G   +  
Sbjct  78   IMEGYDTAILNSLYALPIFAQTFGEYNESTSSWEIPARWQVGLSMCVYCGEMIGLQFTGI  137

Query  91   FSDAFGRKVSLHICAALWIIG-AILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
             +D FG + +L I  +  ++G   +   A    M+ +G+++ G+  G   +    Y SEI
Sbjct  138  LADHFGNRWTL-IGGSFLLLGFNFILYFANSLTMIAIGQILCGIPWGSFQTLCVSYASEI  196

Query  150  SPPKIR------GTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
             P  +R        +  +F   +  G+M      Y       +  +++ + LQ +  + L
Sbjct  197  CPLVLRYYLTTYNNLCWVFGQLIASGVMKASQQQYAA----SSLGYKLPFALQWIWPVPL  252

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE--------QVRFQLEEIKEQV  255
            +VG++  PESP WL    + E+       +++      E        ++R  +E+ K + 
Sbjct  253  IVGIYLAPESPWWLIRKGKMEQARNSTERVLSLPAPEKEDMAGIMVKKIRMTIEKEKMKT  312

Query  256  IIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
              D +     Y++ F+     +T +     M Q L G   ++ Y  Y +  AG   +   
Sbjct  313  STDDS-----YRNCFKGVNARRTRIACITWMVQNLTGC-ALVGYSTYFYEKAGLDTSYAF  366

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S IQYVL +V T+ + FL  K GR  ++  G +     LF   G+  + S  A  G  
Sbjct  367  TFSIIQYVLGIVGTMISWFLSSKVGRFKIIFWGMLSQMIILFITGGLGCSDSKTASWG--  424

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC--SEIFNNMERAKGSAL  433
                                 A S L V  F    G+G  +YC  +EI  +  R K   L
Sbjct  425  ---------------------AGSMLLVLNFVYDTGLGPVVYCVVAEIPTDKLRTKTVVL  463

Query  434  SAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            +       +   +++ P    +  W    KT   +GV++    I  +   PETK +T  E
Sbjct  464  ARNAYNLVSIVNSIWTPYMLNSTEWDWGAKTGFFWGVWTFFCVIWAYLDLPETKDRTFAE  523

Query  490  IDQMWVDNIPAWRTANYIPQ-------LPIVKDEEGNKLGLLGNP  527
            +DQ++   + A + ++   Q       L  +++++ N L ++  P
Sbjct  524  LDQLFYQKVSARKFSSTFVQPFARKTLLEDLREKDNNNLAVIEEP  568


> KLWIg3722 KLWIg3722 undefined product 7538001:7539578 forward 
MW:58536
Length=526

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 101/449 (23%), Positives = 187/449 (42%), Gaps = 66/449 (14%)

Query  70   YGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRV  129
            YG +T+  + G  +GSL++   +D +GRK   +    + +IG+     ++    L++GR+
Sbjct  93   YGLVTSIFSIGGLIGSLVAGPLADTYGRKTITYWNCLIGMIGSFCLFISESYIGLLMGRL  152

Query  130  ISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF  189
            + G+  G      P++ +E+SP  ++G++  + Q S+  GI++   +      +  A   
Sbjct  153  LVGLSCGSLIVVTPLFINEMSPISLKGSLGSMNQVSINCGILLTQSLA-----MIWANTL  207

Query  190  RITWGLQMVPGLILMVG---VFFIPESPRWLANH-------------------------D  221
            +  W L +  G+I  V    +F I ESPRWL +                          D
Sbjct  208  QWRWIL-LFGGIISFVNFALLFKINESPRWLVSRGNMVDAEDVLSQLRGGSRQESRQEID  266

Query  222  RWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI--  279
             W ++S +      +G  N+E+  F    ++      S+ +      L+     PK I  
Sbjct  267  TWLQSSTMPRMHTISGHGNDEENSFPPLSLERPSSTRSSYRESESISLYDYWVDPKYIYP  326

Query  280  --VGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLID  337
              V  +  M QQ CG+N +++Y V +   A    NT ++ +    ++NV++T  +  L+D
Sbjct  327  RRVITAILMAQQFCGINSIVFYGVKVIKKA--FPNTAIIINFAISIINVLITFLSSPLVD  384

Query  338  KFGRRPVLIIGGIFM-FTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVI  396
            ++GR+P+L+     M F       GI+ +YS            VT  I            
Sbjct  385  RWGRKPLLVYSSSIMSFCSFMICIGIIKSYS---------SILVTFII------------  423

Query  397  ASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI  456
                 ++  FA   G   ++  SE+ +        +     NW   F +    P+    I
Sbjct  424  ----FYITAFAGGLGPIPFLIISELSHAETVGVAQSYGTTMNWIATFIVGYSFPALNNMI  479

Query  457  SWKTYIIFGVFSVALTIQTFFMFPETKGK  485
                +++F   +V   +  +   PETKGK
Sbjct  480  GGYVFLLFATVAVCFAMYVYRCVPETKGK  508


> KLDOg3879
Length=529

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 108/488 (23%), Positives = 203/488 (42%), Gaps = 74/488 (15%)

Query  33   FIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFS  92
            +I C + L  G+D     S++G           DS  +G IT+  + G  +GSL++   +
Sbjct  63   YITCRAELNPGYD----DSVLGRLGLSQCIPLTDS-QFGLITSIFSIGGLIGSLVAGPLA  117

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
            D++GRK   +   ++ I GAI    +     +++GR+++G+  G      P++ +E+SP 
Sbjct  118  DSYGRKPISYWNCSIGIFGAIYLFLSDSYYGMLLGRLLAGISCGSLIVITPLFINEMSPA  177

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVG---VFF  209
             ++G++  + Q S+  GI++   +      +  A   +  W L +  GLI +V    +F 
Sbjct  178  HLKGSLGSMNQVSINCGILITQSLA-----MMWANMLQWRWIL-LFGGLISLVNFVLLFK  231

Query  210  IPESPRWLANH-------------------------DRWEETSLIVANIVANGDVNNEQV  244
            I ESPRWL +                          D W + S  V N        N Q 
Sbjct  232  INESPRWLVSQGNMSDAEDVLSQLRGISRQESRQEIDGWIQGSQSVRNFSDLEARGNSQP  291

Query  245  RFQLE-EIKEQVIIDSAAKNFGYKDLFR-----KKTLPKTIVGVSAQMWQQLCGMNVMMY  298
                +  +       S+ ++     L       K   P+ ++  +  M QQ CG+N +++
Sbjct  292  SLGADLHLDRPSSTRSSLRDSESITLLEYWNDPKYRYPRRVI-TTILMAQQFCGINSIVF  350

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y V +   A    +T ++ +    ++NV++T  +  L+D +GR+P+LI   + M    F 
Sbjct  351  YGVKVIKKA--FPDTAIIINFCISLVNVLITFFSSPLVDHWGRKPLLISSSMLMSVCSFM  408

Query  359  VA-GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIY  417
            +  GI+                       EN      ++    L++  FA   G   ++ 
Sbjct  409  ICFGII-----------------------ENAPVL--LVTFVVLYISAFAGGLGPIPFLI  443

Query  418  CSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFF  477
             SE+ ++       +     NW   FA+    P+    +    +++F   +V  ++  + 
Sbjct  444  ISELSHSETVGVAQSYGTTMNWIATFAVGYGFPALNSIMDGYVFLLFSAVAVCFSVYVYK  503

Query  478  MFPETKGK  485
              PETKGK
Sbjct  504  FVPETKGK  511


> KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse 
MW:55940
Length=506

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 121/534 (23%), Positives = 212/534 (40%), Gaps = 111/534 (20%)

Query  13   QYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSS--------------MIGTDVY  58
            Q +GT  +  PH+    V+   AC+  L +G+ +  +++               + T + 
Sbjct  5    QRQGTL-QVTPHLLLTIVV---ACLGSLQYGYHMGELNAPEDYITCQVELDPNYVETFLR  60

Query  59   KDYFSNPDSLT---YGGITASMAGGSFLGSLISPNFSDAFGRK-VSLHICAALWIIGAIL  114
            +   +    LT   YG +T+    G  LGS  + +F+D +GRK VS   C A  + G+ +
Sbjct  61   RLGLAQCVPLTDTQYGLVTSVFTIGGLLGSFFAGSFADKYGRKTVSYWNCLA-GVAGSTI  119

Query  115  QCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLF  174
              A+     +++GR+++G+  G      P++ +E+SP  ++G++  + Q S+  GI++  
Sbjct  120  LFASNGYFGMLMGRLLAGVSCGSLIVVTPLFINEMSPLHLKGSLGSMNQVSINCGILL--  177

Query  175  YIGYGCHFIDGAAAFRITWGLQMVPGLILMVG----------VFFIPESPRWLANH----  220
                         +  I W   +    IL+ G          +F I ESP+WL +     
Sbjct  178  -----------TQSLAIFWANTLQWRFILLFGAAISILNFVLLFKINESPKWLVSKGNLV  226

Query  221  ---------------------DRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
                                 D W   S  ++   A  D   EQ R     ++      S
Sbjct  227  DAEDVLSQLRGTSRQESRQEIDTWLNGSSSISRNFALPD--EEQNRADPLILERPSSTRS  284

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSA----QMWQQLCGMNVMMYYIVYIFN--MAGYTGNT  313
            A ++     L+   + PK ++   A     M QQ CG+N +++Y V +    +  Y    
Sbjct  285  ALRDSESISLYEYWSDPKYMLPRRAITTILMAQQFCGINSIIFYGVKVIKKTLPNYAIQI  344

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA-GILATYSVPAPG  372
            N + S+I    NV++T  +  L+D +GR+P+L I    M    F +  GIL  YS     
Sbjct  345  NFLISTI----NVLVTFFSSPLVDHWGRKPLLTISSSAMSVCSFLICLGILNNYS-----  395

Query  373  GVNGDDTVTIQIPSENTSAANGVIASSYLF-VCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
                                 G++ SS +F +  FA   G   ++  SE+ +        
Sbjct  396  ---------------------GLLVSSVIFYIIAFACGLGPIPFLIISELSHPETVGVAQ  434

Query  432  ALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGK  485
            +     NW   F +    P     I    +++F   +V   +      PETKGK
Sbjct  435  SYGTTMNWIATFVVGYGFPILNSLIDGYVFLLFATVAVIFALYVRMNVPETKGK  488


> KLDOg4807
Length=554

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 81/336 (25%), Positives = 152/336 (46%), Gaps = 26/336 (7%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFS--NPDSLTYG-------GITASMAGGSFLGSLISPN  90
            +M G+D A ++++    V+++ F   N  + T+        G+   +  G  +G  I+  
Sbjct  89   IMEGYDTAFVNNLFALPVFRETFGEFNQTNSTWEIPSKWQIGLGMCVYCGEIIGLQITGT  148

Query  91   FSDAFGRKVSLHICAALWIIGA-ILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
             +D +G ++ L I   + +IG   +   A   AM+ VG+++ G+  G   +    Y SE+
Sbjct  149  LADRYGYRIVL-IGGLIALIGLNFILYFANSLAMIAVGQILCGIPWGSFQTLCVSYASEV  207

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVPGLILMVGV  207
             P  +R  ++        VG ++   +   C  H  +    +R+ + LQ V  + L+VG+
Sbjct  208  CPLVLRYYLTTYINLCWLVGQLIAAGVLKACQEHLANEQLGWRLPFALQWVWPVPLIVGI  267

Query  208  FFIPESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEIKEQVIIDS--AAKNF  264
            +  PESP WL    R E+    V  I+    +  +E     + ++K  V  ++   +++ 
Sbjct  268  YLAPESPWWLVRKGRMEQAKRSVTRILTLPAEEKDELADLMITKMKMTVEKENRLTSQSS  327

Query  265  GYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
             Y D FR     +T +     + Q L G + +M Y  Y +  AG   ++    S +QYV+
Sbjct  328  SYMDCFRGVDSRRTRIACLTWVAQNLTG-SSLMGYSTYFYEKAGLDTSSAFTFSIVQYVI  386

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
             +V T+ +  +  KF      I+G       LF+VA
Sbjct  387  GIVGTLTSCIM--KFHELARNIMG-------LFTVA  413


> KLWIg4655 KLWIg4655 undefined product 9481539:9483257 forward 
MW:62214
Length=573

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 119/477 (25%), Positives = 191/477 (41%), Gaps = 88/477 (18%)

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQC------AAQDQAMLIV  126
            I  S + G+ +G L     +D  GRK        + I+  +LQC      A    A+   
Sbjct  99   IKVSTSVGTVIGQLGFGILADVVGRKKIYGTELIIMIVATVLQCTLGKSPAVSFVAVFAF  158

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFS-----VTVGIMVLFYIGY---  178
             R++ G+GIG     + +  SE S  K RG I G    +     ++ G++ L  +     
Sbjct  159  YRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGLVALILVAAYKG  218

Query  179  --------GCHFIDGAAA---FRITWGLQMVPGLILMVGVFFIPESPRWLANHD-RWEET  226
                     C  +   A    +RI  GL  VPG I +     IPESPR+  + D    + 
Sbjct  219  DLENSTTGNCDEVCRKACDQMWRILIGLGCVPGCIALYFRLTIPESPRYTLDVDMDINKA  278

Query  227  SLIVANIVANGDVNNEQVRF-QLEEIKEQV-IIDSAAKNFGYKDLFRK----KTLPKTIV  280
            +   A  ++    N EQ    +LE+    V  ++    +  ++D  R     K + K I+
Sbjct  279  AADSAKFISGEHGNAEQEDIARLEKAPTAVETVEIKPPSASFRDFCRHFNQWKHM-KIII  337

Query  281  GVSAQMWQQLCGMNVMMYYI----VYIFNMAGYTGNTN----LVASSI-QYVLNVVMTIP  331
            G +A  W  L   +V  Y +      I    GY  ++N    L  S++   +L    ++P
Sbjct  338  G-TAGSWFLL---DVAFYGVSLNSAVILQTIGYASSSNVYKKLYNSAVGNLILICAGSLP  393

Query  332  ----ALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
                ++  ID  GR+P+ ++ G  + T LF + G  A + V       GD          
Sbjct  394  GYWASVATIDTIGRKPIQLM-GFTILTVLFCIIG-FAYHKV-------GD----------  434

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW----AFNF  443
                 +G++A   L   FF     +  +I   E F    R+    +SAA+          
Sbjct  435  -----HGLLALYVLCQFFFNFGPNVTTFIVPGECFPTRYRSTAHGISAASGKIGAIIAQT  489

Query  444  ALAMFVPS------AFKNISWKTYI--IFGVFSVALTIQTFFMFPETKGKTLEEIDQ  492
            AL   +          KN  W  ++  IF +F + L I T  + PETK KTLE+I +
Sbjct  490  ALGTLIDHNCARDGKAKN-CWLPHVMQIFALFML-LGIFTTLLIPETKRKTLEQISE  544


> KLAEg1606 KLAEg1606 undefined product 3385669:3387396 forward 
MW:62811
Length=576

 Score = 51.6 bits (122),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 121/492 (25%), Positives = 189/492 (39%), Gaps = 92/492 (18%)

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQA------MLIV  126
            I  S + G+ +G +     +D  GRK        + I   I+QC     A      +   
Sbjct  102  IKVSTSVGTIIGQVGFGVLADVVGRKRIYGTELIVMITFTIMQCMLGSSAGINFVAVFTF  161

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFS-----VTVGIMVLFYIGY---  178
             R++ G+GIG     + +  SE S  K RG I G    +     +T GI+ L  I     
Sbjct  162  CRILMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLTGGIVALIVIAAYKS  221

Query  179  --------GCHFIDGAAA---FRITWGLQMVPGLILMVGVFFIPESPRW-LANHDRWEET  226
                     C +    A    +RI  GL  VPG I +     IPESPR+ L       + 
Sbjct  222  DLSGNPTDNCDYACQKACDQMWRILIGLGCVPGFIALYFRLTIPESPRYTLDVSTDLNKG  281

Query  227  SLIVANIVANGDVNNEQVRF-QLEEIKEQV-IIDSAAKNFGYKDL---FRKKTLPKTIVG  281
                A  V+    N EQ    +LE+    V  I+       +KD    F++    K ++G
Sbjct  282  VADAAKFVSGEHGNAEQEEIARLEKAPTAVEPIEINPPKASFKDFCRHFKQWKHMKILIG  341

Query  282  VSAQMWQQLCGMNVMMYYI----VYIFNMAGYTGNTN----LVASSI-QYVLNVVMTIP-  331
             +   +     M+V  Y I      I    GY  +T+    L  S++   +L    ++P 
Sbjct  342  TAGSWFF----MDVAFYGINLNTPVILQTIGYASSTDVYEKLYNSAVGNLILICAGSLPG  397

Query  332  ---ALFLIDKFGRRPVLIIGGIFMFTWLFSVAG----------ILATYSVPAPGGVNGDD  378
               ++  +D  GR+P+ ++G I     LF V G          +LA Y +       G +
Sbjct  398  YWASVATVDTVGRKPIQLMGFIINLV-LFCVIGFAYDKLSDHALLALYVLCQFFLNFGPN  456

Query  379  TVTIQIPSEN-----TSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
            T T  +P E       S A+G+ A++       A T  +G  I       +   AK    
Sbjct  457  TTTFIVPGEAFPTRYRSTAHGISAAAGKVGAVIAQT-ALGTLI-------DHNCAKN---  505

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
              A N      + +F            +++ G+F       T F+ PETK KTLEEI + 
Sbjct  506  GEAKNCWLPHVMEIFA----------LFMLCGIF-------TSFLIPETKRKTLEEITEQ  548

Query  494  WVDNIPAWRTAN  505
            +   I   + A+
Sbjct  549  YHGEIDPCKYAS  560


> KLAEg2867 KLAEg2867 undefined product 6050819:6052582 reverse 
MW:65659
Length=588

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 36/71 (51%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L      +++G +L C A++     V R I G+G G  S+ + +  S+I
Sbjct  110  KLSDITGRKTALLTAHFFFLVGCLLTCFARNLTEFSVSRAICGIGAGGISALSSITVSDI  169

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  170  CTPKERGIYQG  180


> KLWIg3964 KLWIg3964 undefined product 8030823:8032538 reverse 
MW:63428
Length=572

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 35/71 (50%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  +L++IG +  C +       + R + GMG G  ++ + +  S+I
Sbjct  92   KLSDITGRKTALMVAHSLFMIGCLFTCFSTSLEQFAISRAVCGMGAGGINALSSITVSDI  151

Query  150  SPPKIRGTISG  160
               K RG   G
Sbjct  152  CSAKERGVYQG  162


> KLDOg4259
Length=573

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 35/71 (50%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  + +++G +    + +     + R + GMG G  S+ + +  S+I
Sbjct  97   KLSDLTGRKTALMLAHSFFLVGCLCTALSNNLTQFSLARAVCGMGAGGISALSSITVSDI  156

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  157  CTPKERGVYQG  167


> KLDOg2399
Length=171

 Score = 42.4 bits (98),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (27%), Positives = 58/123 (48%), Gaps = 8/123 (6%)

Query  405  FFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KT  460
            F+  T G  ++   SEI ++  R K   L+           ++  P    +  W    KT
Sbjct  32   FYNSTLGPVVYCVVSEIPSDRLRTKTVVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKT  91

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPA--WRTANYIP--QLPIVKDE  516
             + +G F+       +F  PETKG+T  E+D+++ + IPA  +++ +  P  +  ++KD 
Sbjct  92   GLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHEKIPARNFKSTHVEPFARETMMKDI  151

Query  517  EGN  519
             GN
Sbjct  152  AGN  154


> KLDOg4817
Length=168

 Score = 41.2 bits (95),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (27%), Positives = 57/123 (47%), Gaps = 8/123 (6%)

Query  405  FFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KT  460
            F+  T G  ++   +EI ++  R K   L+           ++  P    +  W    KT
Sbjct  29   FYNSTLGPVVYCVVTEIPSDRLRTKTVVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKT  88

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPA--WRTANYIP--QLPIVKDE  516
             + +G F+       +F  PETKG+T  E+D+++ + IPA  ++  +  P  +  I+KD 
Sbjct  89   GLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHERIPARKFKGTHVEPFARETIMKDI  148

Query  517  EGN  519
             GN
Sbjct  149  AGN  151


> KLWIg2840 KLWIg2840 undefined product 5783630:5785102 reverse 
MW:54433
Length=491

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (44%), Gaps = 20/144 (13%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG-MGIGFGSSAAPVYCSEI  149
            FSD +GRK +   C  L  +  +L   +Q+ AM  V R  +   G  F +  A +  S++
Sbjct  111  FSDIYGRKPTFIACMCLMCVSLVLTGVSQNLAMFFVFRATTAFFGTSFFTIGAQI-ISDM  169

Query  150  SPPKIRGTISGLF--------QFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
             PP  RG   G              T+G +++ Y  +   F          + L  + G+
Sbjct  170  YPPVRRGGAMGWNIAGSQIGPPLGPTLGGIIITYTSWRVIF----------YVLAGLSGV  219

Query  202  ILMVGVFFIPESPRWLANHDRWEE  225
            +L++ +FF+PE+     + +  EE
Sbjct  220  VLLIAIFFLPETIIRTKHSELLEE  243


> KLAEg112 KLAEg112 undefined product 249419:251197 reverse MW:64943
Length=593

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 0/79 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I G ++   A     L+ GR I+G+G G  +S   +  S+I P
Sbjct  134  SDIFGRRPLIIISNVFFITGCLICGFAPTIWWLVFGRFIAGIGGGGVTSLGSITASDIVP  193

Query  152  PKIRGTISGLFQFSVTVGI  170
             + R    G+F F   +GI
Sbjct  194  LRSRALYQGIFNFFFGLGI  212


> KLDOg83
Length=586

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 39/73 (54%), Gaps = 0/73 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I+G ++   + +   L+ GR I+G+G G  +S   +  S+I P
Sbjct  127  SDIFGRRPLIIISNLFFILGCLICGFSSNLWSLVAGRFIAGIGGGGVTSLGSITASDIVP  186

Query  152  PKIRGTISGLFQF  164
             + R    G+F F
Sbjct  187  LRSRALYQGIFNF  199


> KLAEg1395 KLAEg1395 undefined product 2954212:2955972 reverse 
MW:65281
Length=587

 Score = 37.7 bits (86),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 21/87 (25%), Positives = 43/87 (50%), Gaps = 0/87 (0%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
            L SL+    S  FGRKV+L +   ++ +G+++        M++ GRV++G+G     +  
Sbjct  106  LFSLVWGRLSHVFGRKVTLMLGIVVFELGSLVVALGNSMDMILAGRVVAGIGASCIMTMV  165

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVG  169
                + +  P+ RG +  +  F+  + 
Sbjct  166  FAIGTSLVSPRNRGQVILVLSFAFVIA  192


> KLAEg230 KLAEg230 undefined product 494391:495848 forward MW:53356
Length=486

 Score = 37.0 bits (84),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 37/71 (53%), Gaps = 2/71 (2%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG-MGIGFGSSAAPVYCSEI  149
            FSD +GR+++  +C    +I  +L   +Q+ AM  + R  +   G  F +  A +  S+I
Sbjct  105  FSDIYGRRMTFLLCLTFSVISMMLVGLSQNLAMFFIFRATTSFFGSAFFALGAQI-ISDI  163

Query  150  SPPKIRGTISG  160
             PP  RG+  G
Sbjct  164  YPPTERGSAMG  174


> KLAEg2640 KLAEg2640 undefined product 5575575:5577059 reverse 
MW:54716
Length=495

 Score = 36.2 bits (82),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 33/125 (27%), Positives = 61/125 (49%), Gaps = 6/125 (4%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGM-GIGFGSSAAPVYCSEI  149
            FSD +GR+ +  +C  +  I  +L   +Q+ AM  V R  + + G  F +  A +  ++I
Sbjct  115  FSDVYGRRPTFILCMVIMGISMVLTGLSQNLAMFFVFRATTALAGASFFTIGAQM-IADI  173

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT-WGLQMVPGLILMVGVF  208
             PP  RG   G       +G  +   +G     I   +++R+  + L  +  L+L + +F
Sbjct  174  YPPINRGGAMGWNIAGAQIGPPLGPTLG---GIIVTYSSWRVIFYTLAGISSLVLALAIF  230

Query  209  FIPES  213
            F+PE+
Sbjct  231  FLPET  235


> KLDOg4400
Length=553

 Score = 35.0 bits (79),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 25/75 (34%), Positives = 37/75 (50%), Gaps = 4/75 (5%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAA---QDQAMLIVGRVISGMGIGFGSSAAPVYC  146
              SD FGRK  L      +  G +L C A       ML +GR I+G+G G  ++ + +  
Sbjct  89   KLSDVFGRKAILLWSNLCFGFGCVL-CGAPFTNSLKMLCLGRFIAGVGGGGLNTLSTITT  147

Query  147  SEISPPKIRGTISGL  161
            S+I P + RG   G+
Sbjct  148  SDIIPLRQRGVYQGM  162


> KLAEg1396 KLAEg1396 undefined product 2956612:2958378 reverse 
MW:64846
Length=589

 Score = 35.0 bits (79),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 64/134 (48%), Gaps = 8/134 (5%)

Query  44   FDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHI  103
             DI  + ++  T V  D F + D  T G +  + A  + L SL+    +  FGRK +L I
Sbjct  56   LDIIVVVTLFQTLV--DTFHSVD--TAGWLVTAYALPNGLFSLVWGRITHVFGRKATLVI  111

Query  104  CAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQ  163
               ++  G+++   +    ML+ GRV++G+G     +      + +  P+ RG +     
Sbjct  112  GVMIFECGSLIIALSTSMNMLLAGRVVAGIGGSCIMTLVFTIGTSLVEPRNRGQV----L  167

Query  164  FSVTVGIMVLFYIG  177
            F+++   ++ + IG
Sbjct  168  FALSFAFVIAYAIG  181


> KLWIg3139 KLWIg3139 undefined product 6358337:6360121 reverse 
MW:66895
Length=595

 Score = 34.7 bits (78),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 50/107 (47%), Gaps = 15/107 (14%)

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            +FS  D+LT   +  ++  G+  G L    F +  GR++S+ I  AL + G    C    
Sbjct  385  HFSE-DALTVAVVVVNL--GAICGGLFFGQFMEVCGRRLSILI--ALIMAG----CFTYP  435

Query  121  QAMLIVGRVISGMGIGFGSS------AAPVYCSEISPPKIRGTISGL  161
              ML  G  I G G     S        P++ SE+SPP+ R  ++GL
Sbjct  436  AFMLKTGPAILGGGFMLWFSILGVWGVIPIHLSELSPPEARALVAGL  482


 Score = 32.3 bits (72),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (45%), Gaps = 9/125 (7%)

Query  63   SNPDSLTYGGITASMAGGSFL-------GSLISPNFSDAFGRKVSLHICAALWIIGAILQ  115
            ++P +  YG  T  ++ G  L       G++I   ++D + RK     C  L++I  +  
Sbjct  145  TSPLAKLYGKETKDISWGLSLVLFVRSAGAIIFGLWTDGYSRKWPYITCLFLFLICQLCT  204

Query  116  CAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIM--VL  173
                     +  R ISG+ +G     A     E +P K R  +SG+F  + ++G +  ++
Sbjct  205  PFTTTYTQFLGVRWISGIAMGGIYGCASATAIEDAPVKARSILSGIFFAAYSMGFIFAII  264

Query  174  FYIGY  178
            FY  +
Sbjct  265  FYRAF  269


> KLWIg2474 KLWIg2474 undefined product 5039439:5042441 forward 
MW:115485
Length=1001

 Score = 34.7 bits (78),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 27/52 (52%), Gaps = 2/52 (3%)

Query  154  IRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITW--GLQMVPGLIL  203
            +R T   LF FS + GI  +F+ G    F  G   +RI W  G+  + G+IL
Sbjct  164  LRSTYQRLFYFSTSFGIAAIFFCGSSLVFHKGELQWRIYWDFGISYLFGIIL  215


> KLAEg2811 KLAEg2811 undefined product 5942026:5943783 reverse 
MW:65602
Length=586

 Score = 33.5 bits (75),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 49/204 (25%), Positives = 92/204 (46%), Gaps = 17/204 (8%)

Query  64   NPDSLTYGGITASMAGGSFL-------GSLISPNFSDAFGRKVSLHICAALWIIGAILQC  116
            +P +  YG  T+ ++ G  L       G++I   ++D + RK       +L++I  +   
Sbjct  143  SPLASKYGKATSDISWGLSLVLFVRSAGAIIFGIWTDRYSRKWPYITTLSLFLICQLCTP  202

Query  117  AAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIM--VLF  174
             AQ     +  R +SG+ +G   + +     E +P K R  +SGLF  S  +G +  ++F
Sbjct  203  FAQTYEAFLGVRWLSGIAMGGVYACSAATAIEDAPVKARSLLSGLFFSSYGMGFIFAIIF  262

Query  175  YIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVAN-I  233
            Y  +    ++G   +++ +   +    IL+      PE+  +       +   LI+A+ I
Sbjct  263  YRAFLN--VNGDQYWKVQFWFSVWLPAILIGWRLLWPETKYFT---KVLQARQLILADAI  317

Query  234  VANG--DVNNEQVRFQLEEIKEQV  255
             ANG   +  +  R +L  IKE V
Sbjct  318  AANGGEPLPKKNFREKLVGIKETV  341


> KLDOg3059
Length=606

 Score = 33.5 bits (75),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 46/97 (48%), Gaps = 2/97 (2%)

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G++I   ++D + RK     C  L++I  +    A +    +  R ISG+ +G   + A 
Sbjct  193  GAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPFATNYTQFLGVRWISGVAMGGIYACAS  252

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIM--VLFYIGY  178
                E +P K R  +SGLF  +  +G +   +FY  +
Sbjct  253  ATAIEDAPVKARSFLSGLFFTAYAMGFIFATVFYRAF  289


 Score = 32.0 bits (71),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 42/92 (46%), Gaps = 17/92 (18%)

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI  135
            ++ GG F G L+     +  GR++ L I  AL + G    C      ML  G  + G G 
Sbjct  418  AICGGMFFGQLM-----EITGRRLGLLI--ALVMAG----CFTYPAFMLNTGPAVLGGGF  466

Query  136  GFGSSAA------PVYCSEISPPKIRGTISGL  161
                S        P++ SE+SPP+ R  +SGL
Sbjct  467  FLWFSVIGVWGVIPIHLSELSPPEARALVSGL  498


> KLWIg3848 KLWIg3848 undefined product 7778807:7780372 reverse 
MW:58135
Length=522

 Score = 32.0 bits (71),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 43/92 (47%), Gaps = 4/92 (4%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG--MGIGFGSS  140
            +G+LI     D +GRK S  +   L II  I     +  +  +  R I G  MG  FG +
Sbjct  128  IGALIFGYLGDRYGRKYSFCLTMVLIIIIQIGTGFVKTFSAFLGCRAIFGIIMGSVFGVA  187

Query  141  AAPVYCSEISPPKIRGTISGLFQFSVTVGIMV  172
            +A     E +P K R  +SG+FQ     G ++
Sbjct  188  SATAI--ENAPVKARSILSGIFQEGYAFGYLL  217


> KLDOg307
Length=641

 Score = 31.6 bits (70),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 42/105 (40%), Gaps = 4/105 (3%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISP  89
            V+ F A + G  +G D  S+ +   T     Y ++    T G I + M   S    ++  
Sbjct  89   VLLFSAFLCGYGYGLD-GSLRNYYTTYAQNSYSTHSLLSTIGVINSVMGAAS---QVVYA  144

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
              SD +GR          +++G I+Q  A D      G V   +G
Sbjct  145  RLSDVYGRFTLFVTAIVFYVVGTIIQSQAHDVQRYAAGAVFYNIG  189


> KLDOg4084
Length=913

 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (53%), Gaps = 0/44 (0%)

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVP  369
            + + IP L  + KF R  V+ +G + + T LFS   +  T + P
Sbjct  645  IFLCIPLLPFVSKFNRFVVMFLGAVTLLTALFSFTAVPYTETAP  688


> KLDOg807
Length=572

 Score = 30.8 bits (68),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 124/535 (24%), Positives = 200/535 (38%), Gaps = 87/535 (16%)

Query  26   YNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGS  85
            Y+I  I        L   +DI +++  +    Y  +  +  S T   I  S + G+ +G 
Sbjct  52   YHIRAIAVAGV-GFLTDSYDIFAINLGLSMIDYVYWNGHIPSSTSTLIKVSTSVGTVIGQ  110

Query  86   LISPNFSDAFGRKVSLHICAALWIIGAILQC------AAQDQAMLIVGRVISGMGIGFGS  139
                  +D  GRK        + I   +LQC      A    A+    R+I G+GIG   
Sbjct  111  FGFGIMADVVGRKKIYGTELIVMIAACVLQCTLGHSPAVNFVAVFTFYRIIMGIGIGGDY  170

Query  140  SAAPVYCSEISPPKIRGTISGLFQFS-----VTVGIMVLFYI-GYGCHFIDGAAA-----  188
              + +  SE S  K RG I G    +     +  GI+ L  +  Y     D  A      
Sbjct  171  PLSSIITSEFSTTKWRGAIMGAVFANQAWGQIAAGIVALVLVAAYKGDLDDSTAGNCGPA  230

Query  189  --------FRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
                    +RI  GL  +PG + +     IPESPR+  + +      +  A    +G+  
Sbjct  231  CMKACDQMWRILIGLGCLPGCVALYFRLTIPESPRYTLDVNMNLSKGVADAAKFTSGEHG  290

Query  241  N-EQVRF-QLEE----IKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMN  294
            N EQ    +LE+    ++   I    A    +   F +    K ++G +A  W  L   +
Sbjct  291  NAEQEEIARLEKAPTAVETMEIKPPVASFRDFTRHFNQWKHMKILIG-TAGSWFLL---D  346

Query  295  VMMYYI----VYIFNMAGYTGNTN----LVASSI-QYVLNVVMTIPALFL----IDKFGR  341
            V  Y +      I    GY  + N    L  S++   +L    ++P  ++    ID  GR
Sbjct  347  VAFYGVSLNSAVILQTIGYASSNNVYKKLYNSAVGNLILICAGSLPGYWVSVATIDTVGR  406

Query  342  RPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYL  401
            +P+ ++ G  + T LF + G                        + +    +G++A   L
Sbjct  407  KPIQLM-GFTILTILFCIIGF-----------------------AYDKLGDHGLLALYVL  442

Query  402  FVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW----AFNFALAMFVPS------  451
               FF     +  +I   E F    R+    +SAA+          AL   +        
Sbjct  443  CQFFFNFGPNVTTFIVPGECFPTRYRSSAHGISAASGKIGAIIAQTALGTLIDHNCAKDG  502

Query  452  AFKNISWKTYI--IFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTA  504
              KN  W  ++  IF +F +   I T  + PETK KTLE+I +     I   R A
Sbjct  503  KSKN-CWLPHVMEIFALFMLC-GIFTTLLIPETKRKTLEQISEECHGEIDPSRYA  555


> KLDOg3719
Length=433

 Score = 30.4 bits (67),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 29/124 (24%), Positives = 53/124 (43%), Gaps = 9/124 (7%)

Query  183  IDGAAAFRITWGLQMVPGL---ILMVGVFFIPESPRWLANHDRWEETSLIVANI----VA  235
            + G+    +  G ++ P     I  VG FF+  + R L NH  W E   I A      V 
Sbjct  7    LSGSVGATVESGAKLSPSARRPIEPVGKFFLHHAQRTLRNH-TWSEFEKIEAEKNVRNVE  65

Query  236  NGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNV  295
              +V+ +++ F   E+ ++ ++   A+++   DL+    L K     S Q   +     V
Sbjct  66   ESNVDPDELLFDT-ELADESLLTHDARDWKTADLYAAMGLSKLRYRASQQQIIKAHRKQV  124

Query  296  MMYY  299
            + Y+
Sbjct  125  LKYH  128


> KLDOg4012
Length=527

 Score = 30.4 bits (67),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 33/131 (26%), Positives = 63/131 (49%), Gaps = 18/131 (13%)

Query  40   LMFGFDIASMSS--MIGTDVYKDYFSNPDSLTYGGITASMAG-GSFLGSLISPNFSDAFG  96
            LM GF+ +S  S  +  T +   Y  + D+ T   +T S+A  G+  G +I  + S   G
Sbjct  299  LMAGFNFSSHGSQDLFPTMLTSQYQFSADAST---VTNSVANLGAIAGGIIVAHSSSFIG  355

Query  97   RKVSLHIC-----AALWIIGAILQCAAQDQAMLIVGRVISGM-GIGFGSSAAPVYCSEIS  150
            R+ ++ +C     A L+  G I   +  + ++  +   + G  GI       P++ +E++
Sbjct  356  RRFAILLCCIGGGAMLYPWGFIANKSGLNASVFFLQFFVQGAWGI------VPIHLTELA  409

Query  151  PPKIRGTISGL  161
            P + R  I+G+
Sbjct  410  PAEFRALITGV  420


> KLWIg364 KLWIg364 undefined product 758710:760620 reverse MW:71960
Length=637

 Score = 29.3 bits (64),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 43/105 (41%), Gaps = 4/105 (3%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISP  89
            V+ F A + G  +G D  ++  +  T     Y ++    T G + + +A  S    +I  
Sbjct  86   VLLFSAFLCGYGYGLD-GNLRYVYTTYATNSYSTHSLLSTIGVVNSVIAAAS---QIIYA  141

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
              SD FGR          +++G I++  A D      G V   +G
Sbjct  142  RLSDVFGRLTLFITAIVFYVVGTIIESQAYDVQRYAAGAVFYNVG  186


> KLWIg2920 KLWIg2920 undefined product 5918867:5920390 reverse 
MW:57525
Length=508

 Score = 29.3 bits (64),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 104/248 (42%), Gaps = 34/248 (13%)

Query  27   NIYVIGFIACISGLMFGFDIASM---SSM-IGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
            +I+V+ F+ CI  LMF  D A +   +SM I  ++  D FSN  ++       +     +
Sbjct  62   DIFVLPFLCCIYLLMF-LDKALLNYAASMGIKDNLKGDEFSNLGTIFSASYIFAEPIAVY  120

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
            L  L     S   G   S  +C   W I  +  C  +  A L+V RV+    +G   S +
Sbjct  121  L--LQKYPVSRVIG---SFIVC---WGIIVVCHCVCKTYASLMVIRVL----LGAFESCS  168

Query  143  PVYCSEIS----PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ-M  197
             V C  +S        + +  G +      G ++   I +G  F+        +W +  +
Sbjct  169  AVACITVSGMYYTKSEQSSRIGYWASQAGTGYIIGGLISFG--FLHYHGEHFASWQIMFL  226

Query  198  VPGLIL----MVGVFFIPE--SPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI  251
            V GLI     ++ +F++P+  +  W  N    EE   ++ +I +N     E  +F+   +
Sbjct  227  VVGLITVLFGLITIFYLPDNVTNAWFLNQ---EEKVEVLEHIRSN-QTGVETKKFKWSHV  282

Query  252  KEQVIIDS  259
            +E V  D 
Sbjct  283  RELVFHDQ  290


> KLWIg1767 KLWIg1767 undefined product 3621773:3623632 reverse 
MW:69428
Length=620

 Score = 29.3 bits (64),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 15/45 (34%), Positives = 22/45 (49%), Gaps = 0/45 (0%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI  135
             SD FGR   + +   L+I+G I+Q  A D      G V   +G+
Sbjct  128  LSDIFGRMTLMFVGIVLYIVGTIIQSQAYDVQRYAAGAVFYNVGL  172


> KLDOg2883
Length=585

 Score = 28.1 bits (61),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 24/122 (20%), Positives = 55/122 (46%), Gaps = 4/122 (3%)

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G+L    F++ +GRK++  IC  L ++GA+    A      I  ++  G+      +   
Sbjct  116  GTLFLAPFANLYGRKITYIICILLGLLGALWFALASSTKDTIWSQLFVGISESCAEAQVQ  175

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFR-ITWGLQMVPGLI  202
            +  ++I      G++  ++  + ++G  +   I     +I    +FR + W   ++ G +
Sbjct  176  LSLTDIYFQHQLGSVLTVYILATSIGTFLGPLIA---GYIASLTSFRWVGWCAVIISGAL  232

Query  203  LM  204
            L+
Sbjct  233  LV  234


> KLDOg984
Length=620

 Score = 28.1 bits (61),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 33/84 (40%), Gaps = 6/84 (7%)

Query  56   DVYKDYFSNP----DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIG  111
            DVY  Y +N       LT   I   M   S +  L     SD FGR   + +    + +G
Sbjct  91   DVYTTYAANSYDTHSLLTTIAIVNMMI--SAVAQLFFAGLSDVFGRLSLMIVAVVFYFVG  148

Query  112  AILQCAAQDQAMLIVGRVISGMGI  135
             I+Q  A D      G V   +G+
Sbjct  149  TIIQSQAYDVQRYCAGSVFYTVGL  172


> KLWIg4778 KLWIg4778 undefined product 9751232:9753124 reverse 
MW:71140
Length=631

 Score = 28.1 bits (61),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 23/84 (28%), Positives = 35/84 (42%), Gaps = 6/84 (7%)

Query  56   DVYKDYFSNPDS----LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIG  111
            +VY  Y +N  S    L+  G+   + G +    +     SD FGR   L I    + +G
Sbjct  100  NVYTTYATNSYSSHSLLSTIGVINLVIGAA--AQIFYARLSDVFGRLTLLLISIVFYSVG  157

Query  112  AILQCAAQDQAMLIVGRVISGMGI  135
             I+Q  A D      G V   +G+
Sbjct  158  TIIQSQAYDVQRYAAGAVFYNVGL  181



Lambda     K      H
   0.324    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 2566881000


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>hgt
MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTY
GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSS
AAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI
PESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIV
GVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGI
FMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE
IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI
DQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGLLDRSDSASNSN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)